Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4877999..4878759 | Replicon | chromosome |
| Accession | NZ_CP118774 | ||
| Organism | Citrobacter braakii strain ASE1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7L6U900 |
| Locus tag | PXN04_RS23135 | Protein ID | WP_019077936.1 |
| Coordinates | 4877999..4878310 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PXN04_RS23140 | Protein ID | WP_141876133.1 |
| Coordinates | 4878307..4878759 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXN04_RS23105 (PXN04_23105) | 4873666..4874568 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| PXN04_RS23110 (PXN04_23110) | 4874565..4875200 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PXN04_RS23115 (PXN04_23115) | 4875197..4876126 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| PXN04_RS23120 (PXN04_23120) | 4876163..4876537 | - | 375 | WP_016155182.1 | type II toxin-antitoxin system VapC family toxin | - |
| PXN04_RS23125 (PXN04_23125) | 4876537..4876779 | - | 243 | WP_016155181.1 | CopG family transcriptional regulator | - |
| PXN04_RS23130 (PXN04_23130) | 4876985..4877914 | + | 930 | WP_169330465.1 | alpha/beta hydrolase | - |
| PXN04_RS23135 (PXN04_23135) | 4877999..4878310 | + | 312 | WP_019077936.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PXN04_RS23140 (PXN04_23140) | 4878307..4878759 | + | 453 | WP_141876133.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PXN04_RS23145 (PXN04_23145) | 4878777..4879718 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| PXN04_RS23150 (PXN04_23150) | 4879763..4880200 | - | 438 | WP_016157874.1 | D-aminoacyl-tRNA deacylase | - |
| PXN04_RS23155 (PXN04_23155) | 4880197..4881069 | - | 873 | WP_019077938.1 | virulence factor BrkB family protein | - |
| PXN04_RS23160 (PXN04_23160) | 4881063..4881662 | - | 600 | WP_016155174.1 | glucose-1-phosphatase | - |
| PXN04_RS23165 (PXN04_23165) | 4881767..4882570 | - | 804 | WP_016155173.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PXN04_RS23170 (PXN04_23170) | 4882604..4883500 | - | 897 | WP_103928802.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12502.67 Da Isoelectric Point: 9.9988
>T273432 WP_019077936.1 NZ_CP118774:4877999-4878310 [Citrobacter braakii]
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
MHVISRKPFNEAILRFPNHMAALVDLLNILEKKMFHTPEEMKQYIPSLDNFKYRNKWWVINVSGNCLRLIAYIDFKLQKV
FVKHIVHHAEYDRLTTYYRGHKE
Download Length: 312 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16998.39 Da Isoelectric Point: 5.9259
>AT273432 WP_141876133.1 NZ_CP118774:4878307-4878759 [Citrobacter braakii]
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
MRTHESHQIDTASVKLMIDTFTDAVKKIPLLGKEQNETEYRKALALVEFLVDRDDLENPLFELLSARIRDYEKHAPEFSA
LNQQLEHTPHGVALLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVSHIKMLAERFNLPADAFIE
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|