Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2762215..2762551 | Replicon | chromosome |
Accession | NZ_CP118755 | ||
Organism | Enterococcus faecalis strain W5 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | PWA41_RS13380 | Protein ID | WP_016619108.1 |
Coordinates | 2762215..2762358 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2762502..2762551 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWA41_RS13365 (2757931) | 2757931..2758563 | - | 633 | WP_002358972.1 | RloB family protein | - |
PWA41_RS13370 (2758572) | 2758572..2759867 | - | 1296 | WP_275016500.1 | AAA family ATPase | - |
PWA41_RS13375 (2760329) | 2760329..2761945 | + | 1617 | WP_153246973.1 | phosphatase PAP2/LCP family protein | - |
- (2762041) | 2762041..2762104 | - | 64 | NuclAT_8 | - | - |
PWA41_RS13380 (2762215) | 2762215..2762358 | + | 144 | WP_016619108.1 | putative holin-like toxin | Toxin |
- (2762502) | 2762502..2762551 | + | 50 | NuclAT_9 | - | Antitoxin |
- (2762290) | 2762290..2762552 | - | 263 | NuclAT_7 | - | - |
PWA41_RS13385 (2762553) | 2762553..2767244 | - | 4692 | WP_153246974.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5191.13 Da Isoelectric Point: 8.6626
>T273416 WP_016619108.1 NZ_CP118755:2762215-2762358 [Enterococcus faecalis]
MNVSTKTYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKTYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT273416 NZ_CP118755:2762502-2762551 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|