Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 387501..387695 | Replicon | chromosome |
Accession | NZ_CP118755 | ||
Organism | Enterococcus faecalis strain W5 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PWA41_RS02060 | Protein ID | WP_015543884.1 |
Coordinates | 387600..387695 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 387501..387565 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWA41_RS02045 (383119) | 383119..384861 | + | 1743 | WP_016627729.1 | PTS transporter subunit EIIC | - |
PWA41_RS02050 (384852) | 384852..386885 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
PWA41_RS02055 (386896) | 386896..387330 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (387501) | 387501..387565 | + | 65 | NuclAT_10 | - | Antitoxin |
PWA41_RS02060 (387600) | 387600..387695 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PWA41_RS02065 (387941) | 387941..389713 | + | 1773 | WP_010819728.1 | PTS mannitol-specific transporter subunit IIBC | - |
PWA41_RS02070 (389728) | 389728..390165 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PWA41_RS02075 (390180) | 390180..391334 | + | 1155 | WP_016627726.1 | mannitol-1-phosphate 5-dehydrogenase | - |
PWA41_RS02080 (391402) | 391402..392517 | - | 1116 | WP_016627725.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T273401 WP_015543884.1 NZ_CP118755:c387695-387600 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT273401 NZ_CP118755:387501-387565 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|