Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4326286..4326914 | Replicon | chromosome |
| Accession | NZ_CP118723 | ||
| Organism | Serratia marcescens strain AHRB3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8G2G488 |
| Locus tag | PWO23_RS20655 | Protein ID | WP_016930174.1 |
| Coordinates | 4326286..4326576 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PWO23_RS20660 | Protein ID | WP_016930175.1 |
| Coordinates | 4326591..4326914 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWO23_RS20645 (PWO23_20655) | 4322860..4324881 | + | 2022 | WP_033639320.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PWO23_RS20650 (PWO23_20660) | 4324916..4326055 | - | 1140 | WP_016930173.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PWO23_RS20655 (PWO23_20665) | 4326286..4326576 | + | 291 | WP_016930174.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWO23_RS20660 (PWO23_20670) | 4326591..4326914 | + | 324 | WP_016930175.1 | HigA family addiction module antitoxin | Antitoxin |
| PWO23_RS20665 (PWO23_20675) | 4326907..4327419 | + | 513 | WP_016930176.1 | M48 family metallopeptidase | - |
| PWO23_RS20670 (PWO23_20680) | 4327469..4328449 | + | 981 | WP_274985087.1 | Gfo/Idh/MocA family oxidoreductase | - |
| PWO23_RS20675 (PWO23_20685) | 4328451..4329182 | + | 732 | WP_079450144.1 | glutamine amidotransferase | - |
| PWO23_RS20680 (PWO23_20690) | 4329435..4330403 | + | 969 | WP_016930179.1 | TerC family protein | - |
| PWO23_RS20685 (PWO23_20695) | 4330667..4331902 | + | 1236 | WP_028128305.1 | serine/threonine transporter SstT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11645.30 Da Isoelectric Point: 10.2782
>T273394 WP_016930174.1 NZ_CP118723:4326286-4326576 [Serratia marcescens]
MIKSFRDRYLEQFYLEGRRSRLIPGALERQLARKLDMLAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAEKIYLDPHQDT
MIKSFRDRYLEQFYLEGRRSRLIPGALERQLARKLDMLAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAEKIYLDPHQDT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|