Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1166678..1167264 | Replicon | chromosome |
Accession | NZ_CP118677 | ||
Organism | Pseudomonas juntendi strain GDW21C697WI |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A6I2K6L8 |
Locus tag | PWA60_RS05320 | Protein ID | WP_029885077.1 |
Coordinates | 1166986..1167264 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | PWA60_RS05315 | Protein ID | WP_029885078.1 |
Coordinates | 1166678..1166977 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWA60_RS05290 (PWA60_05290) | 1162564..1163373 | + | 810 | WP_009686964.1 | tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA | - |
PWA60_RS05295 (PWA60_05295) | 1163445..1163855 | - | 411 | WP_054881203.1 | SufE family protein | - |
PWA60_RS05300 (PWA60_05300) | 1163852..1165057 | - | 1206 | WP_029885081.1 | cysteine desulfurase | - |
PWA60_RS05305 (PWA60_05305) | 1165139..1166173 | - | 1035 | WP_009686960.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | - |
PWA60_RS05310 (PWA60_05310) | 1166205..1166552 | - | 348 | WP_054881204.1 | ArsC family reductase | - |
PWA60_RS05315 (PWA60_05315) | 1166678..1166977 | - | 300 | WP_029885078.1 | type II toxin-antitoxin system antitoxin GraA | Antitoxin |
PWA60_RS05320 (PWA60_05320) | 1166986..1167264 | - | 279 | WP_029885077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWA60_RS05325 (PWA60_05325) | 1167513..1169159 | + | 1647 | WP_029885076.1 | Na+/H+ antiporter | - |
PWA60_RS05330 (PWA60_05330) | 1169703..1170899 | - | 1197 | WP_029888073.1 | succinyldiaminopimelate transaminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10420.72 Da Isoelectric Point: 7.1344
>T273371 WP_029885077.1 NZ_CP118677:c1167264-1166986 [Pseudomonas juntendi]
MIQSFSCADTEALFVTGKTRRWSDIKSVAERKLAMLDAATELRDLRSPPGNRLEALSGNRAGQHSIRVNDQWRLCFTWTD
NGPANVEIIDYH
MIQSFSCADTEALFVTGKTRRWSDIKSVAERKLAMLDAATELRDLRSPPGNRLEALSGNRAGQHSIRVNDQWRLCFTWTD
NGPANVEIIDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|