Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4664410..4665164 | Replicon | chromosome |
| Accession | NZ_CP118633 | ||
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain 2089b | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PWO88_RS22720 | Protein ID | WP_000558166.1 |
| Coordinates | 4664410..4664721 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PWO88_RS22725 | Protein ID | WP_031609809.1 |
| Coordinates | 4664718..4665164 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWO88_RS22690 (4660076) | 4660076..4660978 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PWO88_RS22695 (4660975) | 4660975..4661610 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PWO88_RS22700 (4661607) | 4661607..4662536 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PWO88_RS22705 (4662574) | 4662574..4662948 | - | 375 | WP_023243564.1 | type II toxin-antitoxin system VapC family toxin | - |
| PWO88_RS22710 (4662948) | 4662948..4663190 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| PWO88_RS22715 (4663395) | 4663395..4664324 | + | 930 | WP_001162860.1 | alpha/beta hydrolase | - |
| PWO88_RS22720 (4664410) | 4664410..4664721 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PWO88_RS22725 (4664718) | 4664718..4665164 | + | 447 | WP_031609809.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PWO88_RS22730 (4665179) | 4665179..4666120 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PWO88_RS22735 (4666165) | 4666165..4666602 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PWO88_RS22740 (4666599) | 4666599..4667471 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PWO88_RS22745 (4667465) | 4667465..4668064 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PWO88_RS22750 (4668255) | 4668255..4669058 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PWO88_RS22755 (4669092) | 4669092..4669988 | - | 897 | WP_023243565.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T273349 WP_000558166.1 NZ_CP118633:4664410-4664721 [Salmonella enterica subsp. enterica serovar Anatum]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16721.00 Da Isoelectric Point: 6.0016
>AT273349 WP_031609809.1 NZ_CP118633:4664718-4665164 [Salmonella enterica subsp. enterica serovar Anatum]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEETPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEETPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|