Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
| Location | 4730615..4731157 | Replicon | chromosome |
| Accession | NZ_CP118631 | ||
| Organism | Mucilaginibacter sp. SJ | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | MusilaSJ_RS19575 | Protein ID | WP_274986542.1 |
| Coordinates | 4730882..4731157 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | MusilaSJ_RS19570 | Protein ID | WP_274986541.1 |
| Coordinates | 4730615..4730878 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MusilaSJ_RS19545 (MusilaSJ_19545) | 4726626..4727321 | + | 696 | WP_274986536.1 | DUF4397 domain-containing protein | - |
| MusilaSJ_RS19550 (MusilaSJ_19550) | 4727330..4728070 | + | 741 | WP_274986537.1 | DUF4397 domain-containing protein | - |
| MusilaSJ_RS19555 (MusilaSJ_19555) | 4728116..4728766 | + | 651 | WP_274986538.1 | VTT domain-containing protein | - |
| MusilaSJ_RS19560 (MusilaSJ_19560) | 4728790..4729467 | - | 678 | WP_274986539.1 | hypothetical protein | - |
| MusilaSJ_RS19565 (MusilaSJ_19565) | 4729565..4730527 | - | 963 | WP_274986540.1 | zinc dependent phospholipase C family protein | - |
| MusilaSJ_RS19570 (MusilaSJ_19570) | 4730615..4730878 | + | 264 | WP_274986541.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MusilaSJ_RS19575 (MusilaSJ_19575) | 4730882..4731157 | + | 276 | WP_274986542.1 | Txe/YoeB family addiction module toxin | Toxin |
| MusilaSJ_RS19580 (MusilaSJ_19580) | 4731216..4731974 | - | 759 | WP_274986543.1 | class I SAM-dependent methyltransferase | - |
| MusilaSJ_RS19585 (MusilaSJ_19585) | 4732221..4732475 | + | 255 | WP_090529771.1 | 30S ribosomal protein S20 | - |
| MusilaSJ_RS19590 (MusilaSJ_19590) | 4732560..4733258 | + | 699 | WP_274986544.1 | DNA repair protein RadC | - |
| MusilaSJ_RS19595 (MusilaSJ_19595) | 4733401..4735800 | + | 2400 | WP_274986545.1 | phenylalanine--tRNA ligase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10841.30 Da Isoelectric Point: 7.9025
>T273330 WP_274986542.1 NZ_CP118631:4730882-4731157 [Mucilaginibacter sp. SJ]
MITEFTQHGWNDFEYWLENDLEVVEKIRELIKSIKQTPFKGLGKPEPLRHSLKGYWSRRITGEHRLVYQVSGTKGDDQRC
SIVQCRFHYGE
MITEFTQHGWNDFEYWLENDLEVVEKIRELIKSIKQTPFKGLGKPEPLRHSLKGYWSRRITGEHRLVYQVSGTKGDDQRC
SIVQCRFHYGE
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|