Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 588270..588924 | Replicon | plasmid pVWJL.P1 |
| Accession | NZ_CP118630 | ||
| Organism | Pantoea dispersa strain VWJL.P1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PWF83_RS22150 | Protein ID | WP_058781070.1 |
| Coordinates | 588270..588641 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A246NDM6 |
| Locus tag | PWF83_RS22155 | Protein ID | WP_021508926.1 |
| Coordinates | 588625..588924 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWF83_RS22130 (PWF83_22140) | 583547..584926 | + | 1380 | WP_275029492.1 | heavy metal sensor histidine kinase | - |
| PWF83_RS22135 (PWF83_22145) | 584956..585609 | - | 654 | WP_058770319.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| PWF83_RS22140 (PWF83_22150) | 585714..586715 | - | 1002 | WP_264444146.1 | zinc-binding alcohol dehydrogenase family protein | - |
| PWF83_RS22145 (PWF83_22155) | 586852..587769 | + | 918 | WP_058759023.1 | LysR family transcriptional regulator | - |
| PWF83_RS22150 (PWF83_22160) | 588270..588641 | + | 372 | WP_058781070.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PWF83_RS22155 (PWF83_22165) | 588625..588924 | + | 300 | WP_021508926.1 | XRE family transcriptional regulator | Antitoxin |
| PWF83_RS22160 (PWF83_22170) | 589002..589469 | - | 468 | WP_058759022.1 | hypothetical protein | - |
| PWF83_RS22165 (PWF83_22175) | 589655..590584 | - | 930 | WP_059009262.1 | ABC transporter substrate-binding protein | - |
| PWF83_RS22170 (PWF83_22180) | 590594..591328 | - | 735 | WP_058776076.1 | ABC transporter permease | - |
| PWF83_RS22175 (PWF83_22185) | 591312..592028 | - | 717 | WP_058781068.1 | ABC transporter ATP-binding protein | - |
| PWF83_RS22180 (PWF83_22190) | 592025..592993 | - | 969 | WP_058781067.1 | HesA/MoeB/ThiF family protein | - |
| PWF83_RS22185 (PWF83_22195) | 593004..593762 | - | 759 | WP_275029503.1 | thiazole synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | iroN | 1..708540 | 708540 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14338.48 Da Isoelectric Point: 10.0492
>T273328 WP_058781070.1 NZ_CP118630:588270-588641 [Pantoea dispersa]
VWQVEATDRFWKWLQAQDEALRLDVLAALKLLAQDGPHLGRPFVDTLMLSRVPNMKELRVQSKGRPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLHIAETEYHHHLNAIGETHNENLG
VWQVEATDRFWKWLQAQDEALRLDVLAALKLLAQDGPHLGRPFVDTLMLSRVPNMKELRVQSKGRPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLHIAETEYHHHLNAIGETHNENLG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|