Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2015412..2016061 | Replicon | chromosome |
Accession | NZ_CP118629 | ||
Organism | Pantoea dispersa strain VWJL.P1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PWF83_RS09315 | Protein ID | WP_275028868.1 |
Coordinates | 2015711..2016061 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A246NEP9 |
Locus tag | PWF83_RS09310 | Protein ID | WP_021505978.1 |
Coordinates | 2015412..2015711 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWF83_RS09290 (PWF83_09295) | 2010933..2011688 | + | 756 | WP_021505974.1 | pyrroloquinoline-quinone synthase PqqC | - |
PWF83_RS09295 (PWF83_09300) | 2011693..2011971 | + | 279 | WP_021505975.1 | pyrroloquinoline quinone biosynthesis peptide chaperone PqqD | - |
PWF83_RS09300 (PWF83_09305) | 2011958..2013100 | + | 1143 | WP_058758602.1 | pyrroloquinoline quinone biosynthesis protein PqqE | - |
PWF83_RS09305 (PWF83_09310) | 2013100..2015421 | + | 2322 | WP_275028865.1 | pyrroloquinoline quinone biosynthesis protein PqqF | - |
PWF83_RS09310 (PWF83_09315) | 2015412..2015711 | - | 300 | WP_021505978.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PWF83_RS09315 (PWF83_09320) | 2015711..2016061 | - | 351 | WP_275028868.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWF83_RS09320 (PWF83_09325) | 2016271..2016621 | + | 351 | WP_275028870.1 | hypothetical protein | - |
PWF83_RS09325 (PWF83_09330) | 2016671..2018674 | + | 2004 | WP_275028872.1 | protein-disulfide reductase DsbD family protein | - |
PWF83_RS09330 (PWF83_09335) | 2018674..2019396 | + | 723 | WP_031279069.1 | DsbA family protein | - |
PWF83_RS09335 (PWF83_09340) | 2019393..2019896 | + | 504 | WP_104186604.1 | thioredoxin domain-containing protein | - |
PWF83_RS09340 (PWF83_09345) | 2020157..2020993 | + | 837 | WP_275028875.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13372.63 Da Isoelectric Point: 7.7777
>T273319 WP_275028868.1 NZ_CP118629:c2016061-2015711 [Pantoea dispersa]
MWEILTTDVFDDWFLAQNEGLREDMLAVMQILAEMGPKPGRPYVDTLKGCQFTNLKELRVQHAGMPVRAFFALDPVRRAI
VLCAGNKAGCQQKQFYRTMIRLAEAEYRKHLVHMEG
MWEILTTDVFDDWFLAQNEGLREDMLAVMQILAEMGPKPGRPYVDTLKGCQFTNLKELRVQHAGMPVRAFFALDPVRRAI
VLCAGNKAGCQQKQFYRTMIRLAEAEYRKHLVHMEG
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|