Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 6243..6898 | Replicon | chromosome |
Accession | NZ_CP118629 | ||
Organism | Pantoea dispersa strain VWJL.P1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PWF83_RS00030 | Protein ID | WP_058758198.1 |
Coordinates | 6545..6898 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PWF83_RS00025 | Protein ID | WP_058770729.1 |
Coordinates | 6243..6548 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWF83_RS00010 (PWF83_00010) | 1410..2510 | + | 1101 | WP_010617831.1 | DNA polymerase III subunit beta | - |
PWF83_RS00015 (PWF83_00015) | 2690..3775 | + | 1086 | WP_058758201.1 | DNA replication/repair protein RecF | - |
PWF83_RS00020 (PWF83_00020) | 3793..6201 | + | 2409 | WP_058758200.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
PWF83_RS00025 (PWF83_00025) | 6243..6548 | - | 306 | WP_058770729.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PWF83_RS00030 (PWF83_00030) | 6545..6898 | - | 354 | WP_058758198.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PWF83_RS00035 (PWF83_00035) | 7105..7914 | + | 810 | WP_159377266.1 | sugar-phosphatase | - |
PWF83_RS00040 (PWF83_00040) | 8131..8829 | + | 699 | WP_058770730.1 | FadR/GntR family transcriptional regulator | - |
PWF83_RS00045 (PWF83_00045) | 8826..9704 | + | 879 | WP_058758195.1 | 2-dehydro-3-deoxygalactonokinase | - |
PWF83_RS00050 (PWF83_00050) | 9688..10305 | + | 618 | WP_021506907.1 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase | - |
PWF83_RS00055 (PWF83_00055) | 10302..11450 | + | 1149 | WP_058758194.1 | galactonate dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13609.64 Da Isoelectric Point: 9.6733
>T273316 WP_058758198.1 NZ_CP118629:c6898-6545 [Pantoea dispersa]
MWEIIFTDTFREWLRAQDNKLKKRIAAALLNLQHYGPLLPRPYADTVNGSRFHNMKELRIQYAGQPIRALYAFDTQRKAV
ILCAGNKSGDKQFYARMICLADQLFTAYLNNAEENHS
MWEIIFTDTFREWLRAQDNKLKKRIAAALLNLQHYGPLLPRPYADTVNGSRFHNMKELRIQYAGQPIRALYAFDTQRKAV
ILCAGNKSGDKQFYARMICLADQLFTAYLNNAEENHS
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|