Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2476005..2476711 | Replicon | chromosome |
Accession | NZ_CP118615 | ||
Organism | Micromonospora sp. HUAS 3 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | PVK37_RS11425 | Protein ID | WP_275033831.1 |
Coordinates | 2476005..2476400 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PVK37_RS11430 | Protein ID | WP_275033832.1 |
Coordinates | 2476397..2476711 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVK37_RS11400 (PVK37_11400) | 2471049..2471969 | + | 921 | WP_275033826.1 | ABC transporter permease | - |
PVK37_RS11405 (PVK37_11405) | 2472025..2472834 | + | 810 | WP_275033827.1 | ABC transporter permease | - |
PVK37_RS11410 (PVK37_11410) | 2472949..2474151 | + | 1203 | WP_275033828.1 | saccharopine dehydrogenase C-terminal domain-containing protein | - |
PVK37_RS11415 (PVK37_11415) | 2474148..2475158 | + | 1011 | WP_275033829.1 | agmatinase | - |
PVK37_RS11420 (PVK37_11420) | 2475250..2475936 | + | 687 | WP_275033830.1 | G5 domain-containing protein | - |
PVK37_RS11425 (PVK37_11425) | 2476005..2476400 | + | 396 | WP_275033831.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVK37_RS11430 (PVK37_11430) | 2476397..2476711 | + | 315 | WP_275033832.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PVK37_RS11435 (PVK37_11435) | 2476796..2476951 | - | 156 | WP_275033834.1 | DUF433 domain-containing protein | - |
PVK37_RS11440 (PVK37_11440) | 2477104..2477451 | - | 348 | WP_275035085.1 | DUF779 domain-containing protein | - |
PVK37_RS11445 (PVK37_11445) | 2477448..2478953 | - | 1506 | WP_275033835.1 | aldehyde dehydrogenase family protein | - |
PVK37_RS11450 (PVK37_11450) | 2478996..2480324 | - | 1329 | WP_275035086.1 | transcriptional regulator | - |
PVK37_RS11455 (PVK37_11455) | 2480399..2480623 | - | 225 | WP_275033836.1 | DUF397 domain-containing protein | - |
PVK37_RS11460 (PVK37_11460) | 2480636..2481472 | - | 837 | WP_275033837.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14939.96 Da Isoelectric Point: 10.7309
>T273315 WP_275033831.1 NZ_CP118615:2476005-2476400 [Micromonospora sp. HUAS 3]
VGTTGNRRWSVRVTGEVRQWLRDLRQADPSTYHSVSVAIDMLAEVGPALGRPLVDTLRGSQVSNLKELRPRSGRDVAVRV
LFVFDPWSQAVLLVTGNKAGNWTRWYDEHVPLAEKVYKTWLDQERERRGKG
VGTTGNRRWSVRVTGEVRQWLRDLRQADPSTYHSVSVAIDMLAEVGPALGRPLVDTLRGSQVSNLKELRPRSGRDVAVRV
LFVFDPWSQAVLLVTGNKAGNWTRWYDEHVPLAEKVYKTWLDQERERRGKG
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|