Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1491665..1492323 | Replicon | chromosome |
| Accession | NZ_CP118614 | ||
| Organism | Nocardiopsis sp. DZFXJ 01 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | PV789_RS06775 | Protein ID | WP_274976619.1 |
| Coordinates | 1491665..1492018 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | PV789_RS06780 | Protein ID | WP_274976620.1 |
| Coordinates | 1492018..1492323 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PV789_RS06745 (PV789_06745) | 1488038..1488505 | + | 468 | WP_274976616.1 | DUF1232 domain-containing protein | - |
| PV789_RS06750 (PV789_06750) | 1488654..1488959 | - | 306 | WP_047871987.1 | 30S ribosomal protein S14 | - |
| PV789_RS06755 (PV789_06755) | 1488959..1489195 | - | 237 | WP_130396777.1 | 50S ribosomal protein L28 | - |
| PV789_RS06760 (PV789_06760) | 1489286..1490380 | - | 1095 | WP_274978069.1 | GTP-binding protein | - |
| PV789_RS06765 (PV789_06765) | 1490543..1490962 | + | 420 | WP_274976617.1 | VOC family protein | - |
| PV789_RS06770 (PV789_06770) | 1491029..1491316 | - | 288 | WP_274976618.1 | YciI family protein | - |
| PV789_RS06775 (PV789_06775) | 1491665..1492018 | + | 354 | WP_274976619.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PV789_RS06780 (PV789_06780) | 1492018..1492323 | + | 306 | WP_274976620.1 | XRE family transcriptional regulator | Antitoxin |
| PV789_RS06785 (PV789_06785) | 1492402..1492575 | - | 174 | WP_212641121.1 | hypothetical protein | - |
| PV789_RS06790 (PV789_06790) | 1492572..1494263 | - | 1692 | WP_274976621.1 | hypothetical protein | - |
| PV789_RS06795 (PV789_06795) | 1494404..1497178 | - | 2775 | WP_274976622.1 | GTPase-associated protein 1-related protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13190.00 Da Isoelectric Point: 5.6716
>T273311 WP_274976619.1 NZ_CP118614:1491665-1492018 [Nocardiopsis sp. DZFXJ 01]
VWTIELGLVEPWLDQLDQSSYEQVIAALELLAETGPPLGRPLVDAVHGSRHRNMKELRPGSSGRSELRVLFAFDSARKAI
LLVAGDKSGNWNKWYRKNIPIADDLFDEHIEKLRGEA
VWTIELGLVEPWLDQLDQSSYEQVIAALELLAETGPPLGRPLVDAVHGSRHRNMKELRPGSSGRSELRVLFAFDSARKAI
LLVAGDKSGNWNKWYRKNIPIADDLFDEHIEKLRGEA
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|