Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3926784..3927484 | Replicon | chromosome |
Accession | NZ_CP118607 | ||
Organism | Pseudomonas sp. PSKL.D1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | PVV54_RS17450 | Protein ID | WP_274906458.1 |
Coordinates | 3927188..3927484 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | PVV54_RS17445 | Protein ID | WP_274906457.1 |
Coordinates | 3926784..3927185 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVV54_RS17425 (PVV54_17425) | 3921926..3922747 | - | 822 | WP_274906453.1 | transporter substrate-binding domain-containing protein | - |
PVV54_RS17430 (PVV54_17430) | 3922823..3923752 | - | 930 | WP_274906454.1 | FAD-binding protein | - |
PVV54_RS17435 (PVV54_17435) | 3923753..3924502 | - | 750 | WP_274906455.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
PVV54_RS17440 (PVV54_17440) | 3925042..3926724 | + | 1683 | WP_274906456.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
PVV54_RS17445 (PVV54_17445) | 3926784..3927185 | - | 402 | WP_274906457.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
PVV54_RS17450 (PVV54_17450) | 3927188..3927484 | - | 297 | WP_274906458.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
PVV54_RS17455 (PVV54_17455) | 3927579..3928904 | - | 1326 | WP_274906459.1 | MFS transporter | - |
PVV54_RS17460 (PVV54_17460) | 3928975..3929454 | - | 480 | WP_274906460.1 | histidine kinase | - |
PVV54_RS17465 (PVV54_17465) | 3929624..3930100 | - | 477 | WP_274906461.1 | sigma-70 family RNA polymerase sigma factor | - |
PVV54_RS17470 (PVV54_17470) | 3930312..3931484 | + | 1173 | WP_274906462.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11150.06 Da Isoelectric Point: 9.6251
>T273299 WP_274906458.1 NZ_CP118607:c3927484-3927188 [Pseudomonas sp. PSKL.D1]
MEKRMPHCPLERVKALAAEGRVGVTGTALRGARTLGMDFPGILEVVARLERTDFFKSMTSHIDHRVWQDVYRRLTATGYV
YLKVSVIDEVLIVSFKEL
MEKRMPHCPLERVKALAAEGRVGVTGTALRGARTLGMDFPGILEVVARLERTDFFKSMTSHIDHRVWQDVYRRLTATGYV
YLKVSVIDEVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14451.52 Da Isoelectric Point: 5.1967
>AT273299 WP_274906457.1 NZ_CP118607:c3927185-3926784 [Pseudomonas sp. PSKL.D1]
MRCPACGGAELAPDVQGMPYSYKGVATVITGVSGDYCSACGECVLGHDEAMRVSTLMTAFERQVNATVVDPSFIVSIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALIKLFKLLDRHPELFEEVRTA
MRCPACGGAELAPDVQGMPYSYKGVATVITGVSGDYCSACGECVLGHDEAMRVSTLMTAFERQVNATVVDPSFIVSIRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALIKLFKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|