Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1157620..1158224 | Replicon | chromosome |
Accession | NZ_CP118607 | ||
Organism | Pseudomonas sp. PSKL.D1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PVV54_RS05090 | Protein ID | WP_274908897.1 |
Coordinates | 1157904..1158224 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PVV54_RS05085 | Protein ID | WP_274908896.1 |
Coordinates | 1157620..1157907 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVV54_RS05060 (PVV54_05060) | 1153228..1154442 | + | 1215 | WP_274908891.1 | SAM-dependent methyltransferase | - |
PVV54_RS05065 (PVV54_05065) | 1154601..1154879 | + | 279 | WP_274908892.1 | hypothetical protein | - |
PVV54_RS05070 (PVV54_05070) | 1154882..1155391 | + | 510 | WP_274908893.1 | DNA-binding protein | - |
PVV54_RS05075 (PVV54_05075) | 1155411..1156421 | - | 1011 | WP_274908894.1 | DUF4917 family protein | - |
PVV54_RS05080 (PVV54_05080) | 1156534..1157601 | + | 1068 | WP_274908895.1 | glycerophosphodiester phosphodiesterase family protein | - |
PVV54_RS05085 (PVV54_05085) | 1157620..1157907 | - | 288 | WP_274908896.1 | NadS family protein | Antitoxin |
PVV54_RS05090 (PVV54_05090) | 1157904..1158224 | - | 321 | WP_274908897.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVV54_RS05095 (PVV54_05095) | 1158381..1160078 | - | 1698 | WP_274908898.1 | SulP family inorganic anion transporter | - |
PVV54_RS05105 (PVV54_05105) | 1160391..1161275 | - | 885 | WP_274908899.1 | alpha/beta fold hydrolase | - |
PVV54_RS05110 (PVV54_05110) | 1161622..1162314 | - | 693 | WP_274908900.1 | 16S rRNA pseudouridine(516) synthase | - |
PVV54_RS05115 (PVV54_05115) | 1162349..1162573 | - | 225 | WP_274908901.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12018.91 Da Isoelectric Point: 9.4240
>T273297 WP_274908897.1 NZ_CP118607:c1158224-1157904 [Pseudomonas sp. PSKL.D1]
MLFIETPIFSRSVKELLDDEAYRLLQIQLMLSPDLGDLMEGTGGLRKVRVAANGRGKRGGARAIYYHFVASSQIAMLYIY
PKNEQSDLSTEQCKALKGVVEHWRRT
MLFIETPIFSRSVKELLDDEAYRLLQIQLMLSPDLGDLMEGTGGLRKVRVAANGRGKRGGARAIYYHFVASSQIAMLYIY
PKNEQSDLSTEQCKALKGVVEHWRRT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|