Detailed information of TA system TA273291

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 112018..112444
• Replicon: plasmid pNB4833-MCR
• Accession: NZ_CP118603
• Organism: Escherichia coli strain NB4833

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OU688_RS25385
• Protein ID: WP_001372321.1
• Coordinates: 112018..112143 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	112220..112444 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OU688_RS25350 (107073)	107073..107300	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
OU688_RS25355 (107394)	107394..108080	-	687	WP_015059009.1	PAS domain-containing protein	-
OU688_RS25360 (108271)	108271..108654	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OU688_RS25365 (108931)	108931..109578	+	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OU688_RS25370 (109875)	109875..110696	-	822	WP_001234445.1	DUF932 domain-containing protein	-
OU688_RS25375 (110807)	110807..111103	-	297	WP_001272251.1	hypothetical protein	-
OU688_RS25380 (111403)	111403..111699	+	297	Protein_117	hypothetical protein	-
OU688_RS25385 (112018)	112018..112143	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OU688_RS25390 (112085)	112085..112234	-	150	Protein_119	plasmid maintenance protein Mok	-
OU688_RS25395 (112256)	112256..112435	+	180	WP_001309233.1	hypothetical protein	-
- (112220)	112220..112444	-	225	NuclAT_0	-	Antitoxin
- (112220)	112220..112444	-	225	NuclAT_0	-	Antitoxin
- (112220)	112220..112444	-	225	NuclAT_0	-	Antitoxin
- (112220)	112220..112444	-	225	NuclAT_0	-	Antitoxin
OU688_RS25400 (112413)	112413..113175	-	763	Protein_121	plasmid SOS inhibition protein A	-
OU688_RS25405 (113172)	113172..113606	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OU688_RS25410 (113675)	113675..115698	-	2024	Protein_123	ParB/RepB/Spo0J family partition protein	-
OU688_RS25415 (115759)	115759..115992	-	234	WP_000006003.1	DUF905 family protein	-
OU688_RS25420 (116050)	116050..116577	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
OU688_RS25425 (116879)	116879..117334	+	456	Protein_126	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / blaNDM-13 / sitABCD	iroB / iroC / iroD / iroE / iroN	1..145194	145194

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T273291 WP_001372321.1 NZ_CP118603:c112143-112018 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT273291 NZ_CP118603:c112444-112220 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin