Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 72583..72836 Replicon plasmid pNB4833-MCR
Accession NZ_CP118603
Organism Escherichia coli strain NB4833

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag OU688_RS25155 Protein ID WP_001312851.1
Coordinates 72583..72732 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 72777..72836 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OU688_RS25130 (68298) 68298..68915 + 618 WP_000521604.1 ProQ/FINO family protein -
OU688_RS25135 (68974) 68974..69966 - 993 WP_001579760.1 hypothetical protein -
OU688_RS25140 (70882) 70882..71739 - 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
OU688_RS25145 (71732) 71732..71806 - 75 WP_001375168.1 RepA leader peptide Tap -
OU688_RS25150 (72051) 72051..72299 - 249 WP_000083837.1 replication regulatory protein RepA -
OU688_RS25155 (72583) 72583..72732 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (72777) 72777..72836 + 60 NuclAT_1 - Antitoxin
- (72777) 72777..72836 + 60 NuclAT_1 - Antitoxin
- (72777) 72777..72836 + 60 NuclAT_1 - Antitoxin
- (72777) 72777..72836 + 60 NuclAT_1 - Antitoxin
OU688_RS25160 (73037) 73037..73369 - 333 WP_152916585.1 hypothetical protein -
OU688_RS25165 (73431) 73431..74030 - 600 WP_032083981.1 PIN domain-containing protein -
OU688_RS25170 (74416) 74416..74616 - 201 WP_015059022.1 hypothetical protein -
OU688_RS25175 (74748) 74748..75308 - 561 WP_000139328.1 fertility inhibition protein FinO -
OU688_RS25180 (75363) 75363..76109 - 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / blaNDM-13 / sitABCD iroB / iroC / iroD / iroE / iroN 1..145194 145194


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T273287 WP_001312851.1 NZ_CP118603:c72732-72583 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT273287 NZ_CP118603:72777-72836 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References