Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4700835..4701437 | Replicon | chromosome |
Accession | NZ_CP118601 | ||
Organism | Escherichia coli strain NB4833 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | OU688_RS22415 | Protein ID | WP_000897305.1 |
Coordinates | 4701126..4701437 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OU688_RS22410 | Protein ID | WP_000356397.1 |
Coordinates | 4700835..4701125 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU688_RS22385 (4696761) | 4696761..4697663 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
OU688_RS22390 (4697660) | 4697660..4698295 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
OU688_RS22395 (4698292) | 4698292..4699221 | + | 930 | WP_000027706.1 | formate dehydrogenase accessory protein FdhE | - |
OU688_RS22400 (4699551) | 4699551..4699793 | - | 243 | WP_174785388.1 | CopG family transcriptional regulator | - |
OU688_RS22405 (4700012) | 4700012..4700230 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
OU688_RS22410 (4700835) | 4700835..4701125 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
OU688_RS22415 (4701126) | 4701126..4701437 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
OU688_RS22420 (4701666) | 4701666..4702574 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
OU688_RS22425 (4702638) | 4702638..4703579 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
OU688_RS22430 (4703624) | 4703624..4704061 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
OU688_RS22435 (4704058) | 4704058..4704930 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
OU688_RS22440 (4704924) | 4704924..4705523 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T273285 WP_000897305.1 NZ_CP118601:c4701437-4701126 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|