Detailed information of TA system TA273253

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/RelE-MqsA
• Location: 1608356..1608989
• Replicon: chromosome
• Accession: NZ_CP118584
• Organism: Vibrio harveyi strain fish5

Toxin (Protein)

• Gene name: higB
• Uniprot ID: A0A347UQS4
• Locus tag: PWW25_RS07405
• Protein ID: WP_012600340.1
• Coordinates: 1608657..1608989 (-)
• Length: 111 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: PWW25_RS07400
• Protein ID: WP_060531655.1
• Coordinates: 1608356..1608670 (-)
• Length: 105 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PWW25_RS07345	1603742..1603804	-	63	Protein_1427	DUF3265 domain-containing protein	-
PWW25_RS07350	1603801..1605477	-	1677	WP_274877012.1	ATP-binding protein	-
PWW25_RS07355	1605529..1605618	-	90	WP_071881309.1	DUF3265 domain-containing protein	-
PWW25_RS07360	1605636..1605914	-	279	WP_038886177.1	hypothetical protein	-
PWW25_RS07365	1606005..1606094	-	90	WP_071881309.1	DUF3265 domain-containing protein	-
PWW25_RS07370	1606112..1606390	-	279	WP_038886177.1	hypothetical protein	-
PWW25_RS07375	1606481..1606573	-	93	WP_274877013.1	DUF3265 domain-containing protein	-
PWW25_RS07380	1606588..1607031	-	444	WP_072611821.1	hypothetical protein	-
PWW25_RS07385	1607059..1607151	-	93	WP_079877857.1	DUF3265 domain-containing protein	-
PWW25_RS07390	1607830..1608219	-	390	WP_274877014.1	hypothetical protein	-
PWW25_RS07395	1608249..1608341	-	93	WP_012841671.1	DUF3265 domain-containing protein	-
PWW25_RS07400	1608356..1608670	-	315	WP_060531655.1	DNA-binding transcriptional regulator	Antitoxin
PWW25_RS07405	1608657..1608989	-	333	WP_012600340.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
PWW25_RS07410	1609092..1609184	-	93	WP_203493287.1	DUF3265 domain-containing protein	-
PWW25_RS07415	1609205..1609867	-	663	WP_054757462.1	hypothetical protein	-
PWW25_RS07420	1610007..1610696	-	690	WP_274877015.1	hypothetical protein	-
PWW25_RS07425	1610724..1610834	-	111	WP_128812305.1	DUF3265 domain-containing protein	-
PWW25_RS07430	1610872..1611186	-	315	WP_004401149.1	N(4)-acetylcytidine aminohydrolase	-
PWW25_RS07435	1611186..1611509	-	324	WP_274877016.1	hypothetical protein	-
PWW25_RS07440	1612226..1612355	-	130	Protein_1446	DUF3265 domain-containing protein	-
PWW25_RS07445	1612829..1612894	-	66	Protein_1447	DUF3265 domain-containing protein	-
PWW25_RS07450	1612891..1613250	-	360	WP_025523617.1	hypothetical protein	-
PWW25_RS07455	1613270..1613362	-	93	WP_004748931.1	DUF3265 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	1552588..1632942	80354
	-	inside	Integron	-	-	1556911..1632942	76031

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-2 (4-104)

Antitoxin

• Antitoxin MqsA/HigA-2 (24-101)

Sequences

Toxin

Protein

• Length: 111 a.a.
• Molecular weight: 12906.76 Da
• Isoelectric Point: 10.0960

>T273253 WP_012600340.1 NZ_CP118584:c1608989-1608657 [Vibrio harveyi]
MKSVFVESTIFEKYRNEYLSDDEFRLFQAELMSNPKQGDVIQGTGGLRKIRVASKGKGKRGGSRVIYYFLDEKRRFYLLT
IYGKNEMSDLTADQKKQLKAFMEAWRNEQS

Nucleotide

• Length: 333 bp

Antitoxin

Protein

• Length: 105 a.a.
• Molecular weight: 11677.15 Da
• Isoelectric Point: 6.3290

>AT273253 WP_060531655.1 NZ_CP118584:c1608670-1608356 [Vibrio harveyi]
MSSRDLFAELSSALVEAKEHSEGKLTLKTHQVNDISELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSAP
NGQAVTLLKLVQRHPETLSHIAEL

Nucleotide

• Length: 315 bp

Structures

Toxin

• AlphaFold DB: A0A347UQS4