Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4685517..4686119 | Replicon | chromosome |
Accession | NZ_CP118567 | ||
Organism | Enterobacter hormaechei strain 2020CK-00199 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A155DUZ6 |
Locus tag | PXV21_RS22405 | Protein ID | WP_022649837.1 |
Coordinates | 4685808..4686119 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PXV21_RS22400 | Protein ID | WP_022649836.1 |
Coordinates | 4685517..4685807 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV21_RS22385 (PXV21_22385) | 4683015..4683917 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
PXV21_RS22390 (PXV21_22390) | 4683914..4684549 | + | 636 | WP_006808711.1 | formate dehydrogenase cytochrome b556 subunit | - |
PXV21_RS22395 (PXV21_22395) | 4684546..4685475 | + | 930 | WP_022649835.1 | formate dehydrogenase accessory protein FdhE | - |
PXV21_RS22400 (PXV21_22400) | 4685517..4685807 | - | 291 | WP_022649836.1 | NadS family protein | Antitoxin |
PXV21_RS22405 (PXV21_22405) | 4685808..4686119 | - | 312 | WP_022649837.1 | hypothetical protein | Toxin |
PXV21_RS22410 (PXV21_22410) | 4686268..4687209 | - | 942 | WP_022649838.1 | fatty acid biosynthesis protein FabY | - |
PXV21_RS22415 (PXV21_22415) | 4687254..4687691 | - | 438 | WP_022649839.1 | D-aminoacyl-tRNA deacylase | - |
PXV21_RS22420 (PXV21_22420) | 4687688..4688569 | - | 882 | WP_022649840.1 | virulence factor BrkB family protein | - |
PXV21_RS22425 (PXV21_22425) | 4688563..4689162 | - | 600 | WP_022649841.1 | glucose-1-phosphatase | - |
PXV21_RS22430 (PXV21_22430) | 4689281..4690081 | - | 801 | WP_022649842.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PXV21_RS22435 (PXV21_22435) | 4690116..4691012 | - | 897 | WP_022649843.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12148.13 Da Isoelectric Point: 9.4455
>T273241 WP_022649837.1 NZ_CP118567:c4686119-4685808 [Enterobacter hormaechei]
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNTGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNTGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|