Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4459660..4460262 | Replicon | chromosome |
| Accession | NZ_CP118542 | ||
| Organism | Salmonella sp. CVCC 1806 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | PWA52_RS21625 | Protein ID | WP_001159635.1 |
| Coordinates | 4459951..4460262 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PWA52_RS21620 | Protein ID | WP_000362050.1 |
| Coordinates | 4459660..4459950 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA52_RS21605 (4457156) | 4457156..4458058 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PWA52_RS21610 (4458055) | 4458055..4458687 | + | 633 | WP_020937226.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PWA52_RS21615 (4458684) | 4458684..4459613 | + | 930 | WP_000027739.1 | formate dehydrogenase accessory protein FdhE | - |
| PWA52_RS21620 (4459660) | 4459660..4459950 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| PWA52_RS21625 (4459951) | 4459951..4460262 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| PWA52_RS21630 (4460480) | 4460480..4461409 | + | 930 | WP_000171444.1 | alpha/beta hydrolase | - |
| PWA52_RS21635 (4461495) | 4461495..4461806 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
| PWA52_RS21640 (4461803) | 4461803..4462249 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PWA52_RS21645 (4462264) | 4462264..4463205 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PWA52_RS21650 (4463250) | 4463250..4463687 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| PWA52_RS21655 (4463684) | 4463684..4464556 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PWA52_RS21660 (4464550) | 4464550..4465149 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T273209 WP_001159635.1 NZ_CP118542:c4460262-4459951 [Salmonella sp. CVCC 1806]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|