Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 354146..354684 | Replicon | chromosome |
| Accession | NZ_CP118542 | ||
| Organism | Salmonella sp. CVCC 1806 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | M7RHM1 |
| Locus tag | PWA52_RS01610 | Protein ID | WP_001526148.1 |
| Coordinates | 354409..354684 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | PWA52_RS01605 | Protein ID | WP_269724490.1 |
| Coordinates | 354146..354406 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA52_RS01590 (350014) | 350014..351567 | + | 1554 | WP_045161971.1 | TROVE domain-containing protein | - |
| PWA52_RS01595 (351800) | 351800..353014 | + | 1215 | WP_001105533.1 | RNA-splicing ligase RtcB | - |
| PWA52_RS01600 (353018) | 353018..354037 | + | 1020 | Protein_316 | RNA 3'-terminal phosphate cyclase | - |
| PWA52_RS01605 (354146) | 354146..354406 | + | 261 | WP_269724490.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PWA52_RS01610 (354409) | 354409..354684 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PWA52_RS01615 (354772) | 354772..357477 | - | 2706 | WP_023136246.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T273194 WP_001526148.1 NZ_CP118542:354409-354684 [Salmonella sp. CVCC 1806]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|