Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4535282..4536036 | Replicon | chromosome |
| Accession | NZ_CP118537 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | O1A30_RS22255 | Protein ID | WP_000558160.1 |
| Coordinates | 4535282..4535593 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | O1A30_RS22260 | Protein ID | WP_001259009.1 |
| Coordinates | 4535590..4536036 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1A30_RS22225 (O1A30_22225) | 4530948..4531850 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| O1A30_RS22230 (O1A30_22230) | 4531847..4532482 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| O1A30_RS22235 (O1A30_22235) | 4532479..4533408 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| O1A30_RS22240 (O1A30_22240) | 4533446..4533820 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| O1A30_RS22245 (O1A30_22245) | 4533820..4534062 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| O1A30_RS22250 (O1A30_22250) | 4534267..4535196 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| O1A30_RS22255 (O1A30_22255) | 4535282..4535593 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| O1A30_RS22260 (O1A30_22260) | 4535590..4536036 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| O1A30_RS22265 (O1A30_22265) | 4536051..4536992 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| O1A30_RS22270 (O1A30_22270) | 4537037..4537474 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| O1A30_RS22275 (O1A30_22275) | 4537471..4538343 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| O1A30_RS22280 (O1A30_22280) | 4538337..4538936 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| O1A30_RS22285 (O1A30_22285) | 4539127..4539930 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| O1A30_RS22290 (O1A30_22290) | 4539964..4540860 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T273178 WP_000558160.1 NZ_CP118537:4535282-4535593 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT273178 WP_001259009.1 NZ_CP118537:4535590-4536036 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|