Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4638705..4639459 | Replicon | chromosome |
| Accession | NZ_CP118536 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S7 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | PWA19_RS22840 | Protein ID | WP_000558160.1 |
| Coordinates | 4638705..4639016 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PWA19_RS22845 | Protein ID | WP_001259009.1 |
| Coordinates | 4639013..4639459 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWA19_RS22810 (PWA19_22810) | 4634371..4635273 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| PWA19_RS22815 (PWA19_22815) | 4635270..4635905 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PWA19_RS22820 (PWA19_22820) | 4635902..4636831 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| PWA19_RS22825 (PWA19_22825) | 4636869..4637243 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| PWA19_RS22830 (PWA19_22830) | 4637243..4637485 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| PWA19_RS22835 (PWA19_22835) | 4637690..4638619 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PWA19_RS22840 (PWA19_22840) | 4638705..4639016 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PWA19_RS22845 (PWA19_22845) | 4639013..4639459 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PWA19_RS22850 (PWA19_22850) | 4639474..4640415 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PWA19_RS22855 (PWA19_22855) | 4640460..4640897 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PWA19_RS22860 (PWA19_22860) | 4640894..4641766 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PWA19_RS22865 (PWA19_22865) | 4641760..4642359 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PWA19_RS22870 (PWA19_22870) | 4642550..4643353 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| PWA19_RS22875 (PWA19_22875) | 4643387..4644283 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T273163 WP_000558160.1 NZ_CP118536:4638705-4639016 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT273163 WP_001259009.1 NZ_CP118536:4639013-4639459 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|