Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 49659..50386 | Replicon | plasmid pF3-2P2 |
| Accession | NZ_CP118406 | ||
| Organism | Klebsiella pneumoniae strain F3-2P(2*) | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
| Locus tag | HX883_RS25990 | Protein ID | WP_004118600.1 |
| Coordinates | 49659..49970 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | HX883_RS25995 | Protein ID | WP_000990392.1 |
| Coordinates | 49967..50386 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HX883_RS25970 (HX883_025970) | 46173..46892 | + | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
| HX883_RS25975 (HX883_025975) | 46903..48330 | + | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| HX883_RS25980 (HX883_025980) | 48323..49018 | + | 696 | WP_004118595.1 | lactate utilization protein C | - |
| HX883_RS25985 (HX883_025985) | 49068..49448 | - | 381 | Protein_46 | gluconate permease | - |
| HX883_RS25990 (HX883_025990) | 49659..49970 | + | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| HX883_RS25995 (HX883_025995) | 49967..50386 | + | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| HX883_RS26000 (HX883_026000) | 50423..51625 | - | 1203 | WP_003031541.1 | hypothetical protein | - |
| HX883_RS26005 (HX883_026005) | 51618..51947 | - | 330 | WP_004118613.1 | hypothetical protein | - |
| HX883_RS26010 (HX883_026010) | 51944..52603 | - | 660 | WP_000078540.1 | hypothetical protein | - |
| HX883_RS26015 (HX883_026015) | 53027..53383 | - | 357 | WP_077253206.1 | Ref family recombination enhancement nuclease | - |
| HX883_RS26020 (HX883_026020) | 53503..53643 | - | 141 | WP_004118614.1 | hypothetical protein | - |
| HX883_RS26025 (HX883_026025) | 53936..54289 | + | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| HX883_RS26030 (HX883_026030) | 54337..54699 | + | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..216722 | 216722 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T273124 WP_004118600.1 NZ_CP118406:49659-49970 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT273124 WP_000990392.1 NZ_CP118406:49967-50386 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |