Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 769339..770114 | Replicon | chromosome |
Accession | NZ_CP118398 | ||
Organism | Klebsiella pneumoniae strain 2020CK-00223 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | PWK27_RS03900 | Protein ID | WP_021314147.1 |
Coordinates | 769629..770114 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | PWK27_RS03895 | Protein ID | WP_004150912.1 |
Coordinates | 769339..769632 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PWK27_RS03875 (PWK27_03875) | 764547..765149 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
PWK27_RS03880 (PWK27_03880) | 765247..766158 | + | 912 | WP_104159329.1 | LysR family transcriptional regulator | - |
PWK27_RS03885 (PWK27_03885) | 766159..767307 | - | 1149 | WP_020316731.1 | PLP-dependent aspartate aminotransferase family protein | - |
PWK27_RS03890 (PWK27_03890) | 767318..768694 | - | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
PWK27_RS03895 (PWK27_03895) | 769339..769632 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
PWK27_RS03900 (PWK27_03900) | 769629..770114 | + | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
PWK27_RS03905 (PWK27_03905) | 770818..771411 | + | 594 | WP_274759606.1 | hypothetical protein | - |
PWK27_RS03910 (PWK27_03910) | 771508..771724 | + | 217 | Protein_768 | transposase | - |
PWK27_RS03920 (PWK27_03920) | 772239..772952 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 771508..771660 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T273093 WP_021314147.1 NZ_CP118398:769629-770114 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |