Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 344097..344683 | Replicon | chromosome |
| Accession | NZ_CP118398 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00223 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | PWK27_RS01630 | Protein ID | WP_002920800.1 |
| Coordinates | 344315..344683 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A485URP3 |
| Locus tag | PWK27_RS01625 | Protein ID | WP_040226701.1 |
| Coordinates | 344097..344318 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWK27_RS01605 (PWK27_01605) | 340254..341180 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PWK27_RS01610 (PWK27_01610) | 341177..342454 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| PWK27_RS01615 (PWK27_01615) | 342451..343218 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PWK27_RS01620 (PWK27_01620) | 343220..343933 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| PWK27_RS01625 (PWK27_01625) | 344097..344318 | + | 222 | WP_040226701.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PWK27_RS01630 (PWK27_01630) | 344315..344683 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PWK27_RS01635 (PWK27_01635) | 344956..346272 | + | 1317 | WP_274759533.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PWK27_RS01640 (PWK27_01640) | 346379..347266 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| PWK27_RS01645 (PWK27_01645) | 347263..348108 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| PWK27_RS01650 (PWK27_01650) | 348110..349180 | + | 1071 | WP_002920787.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 341177..349917 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T273092 WP_002920800.1 NZ_CP118398:344315-344683 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A485URP3 |