Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 344097..344683 Replicon chromosome
Accession NZ_CP118398
Organism Klebsiella pneumoniae strain 2020CK-00223

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag PWK27_RS01630 Protein ID WP_002920800.1
Coordinates 344315..344683 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A485URP3
Locus tag PWK27_RS01625 Protein ID WP_040226701.1
Coordinates 344097..344318 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWK27_RS01605 (PWK27_01605) 340254..341180 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PWK27_RS01610 (PWK27_01610) 341177..342454 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
PWK27_RS01615 (PWK27_01615) 342451..343218 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PWK27_RS01620 (PWK27_01620) 343220..343933 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PWK27_RS01625 (PWK27_01625) 344097..344318 + 222 WP_040226701.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PWK27_RS01630 (PWK27_01630) 344315..344683 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PWK27_RS01635 (PWK27_01635) 344956..346272 + 1317 WP_274759533.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PWK27_RS01640 (PWK27_01640) 346379..347266 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PWK27_RS01645 (PWK27_01645) 347263..348108 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PWK27_RS01650 (PWK27_01650) 348110..349180 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 341177..349917 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T273092 WP_002920800.1 NZ_CP118398:344315-344683 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8183.21 Da        Isoelectric Point: 4.7769

>AT273092 WP_040226701.1 NZ_CP118398:344097-344318 [Klebsiella pneumoniae]
MRTVNYSEARQNLADMLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A485URP3

References