Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1727798..1728425 Replicon chromosome
Accession NZ_CP118390
Organism Edwardsiella piscicida strain Ep21-8

Toxin (Protein)


Gene name higB Uniprot ID A0A411H7J1
Locus tag PWJ79_RS07960 Protein ID WP_015871332.1
Coordinates 1728096..1728425 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PWJ79_RS07955 Protein ID WP_005286394.1
Coordinates 1727798..1728106 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWJ79_RS07905 (PWJ79_07905) 1722833..1723525 - 693 WP_041692511.1 helix-turn-helix transcriptional regulator -
PWJ79_RS07910 (PWJ79_07910) 1723630..1723845 + 216 WP_012848463.1 YdaS family helix-turn-helix protein -
PWJ79_RS07915 (PWJ79_07915) 1723943..1724299 + 357 WP_012848464.1 hypothetical protein -
PWJ79_RS07920 (PWJ79_07920) 1724296..1724529 + 234 WP_005286423.1 hypothetical protein -
PWJ79_RS07925 (PWJ79_07925) 1724561..1724812 + 252 WP_012848465.1 hypothetical protein -
PWJ79_RS07930 (PWJ79_07930) 1725015..1726013 + 999 WP_012848466.1 DUF1367 family protein -
PWJ79_RS07935 (PWJ79_07935) 1726016..1726318 + 303 WP_012848467.1 DUF1364 family protein -
PWJ79_RS07940 (PWJ79_07940) 1726607..1726852 + 246 WP_012848468.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PWJ79_RS07945 (PWJ79_07945) 1726740..1727108 + 369 WP_196796969.1 Txe/YoeB family addiction module toxin -
PWJ79_RS07950 (PWJ79_07950) 1727191..1727703 - 513 WP_012848469.1 DUF2442 domain-containing protein -
PWJ79_RS07955 (PWJ79_07955) 1727798..1728106 - 309 WP_005286394.1 helix-turn-helix transcriptional regulator Antitoxin
PWJ79_RS07960 (PWJ79_07960) 1728096..1728425 - 330 WP_015871332.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PWJ79_RS07965 (PWJ79_07965) 1728900..1729493 + 594 WP_012848471.1 hypothetical protein -
PWJ79_RS07970 (PWJ79_07970) 1729665..1730003 + 339 WP_012848472.1 phage holin, lambda family -
PWJ79_RS07975 (PWJ79_07975) 1730006..1730557 + 552 WP_012848473.1 glycosyl hydrolase 108 family protein -
PWJ79_RS07980 (PWJ79_07980) 1730747..1731529 + 783 WP_045475170.1 antA/AntB antirepressor family protein -
PWJ79_RS07985 (PWJ79_07985) 1731632..1732177 + 546 WP_041692512.1 DUF2514 family protein -
PWJ79_RS07990 (PWJ79_07990) 1732534..1733310 + 777 WP_012848476.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1701019..1746459 45440


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(16-103)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12771.78 Da        Isoelectric Point: 9.6247

>T273083 WP_015871332.1 NZ_CP118390:c1728425-1728096 [Edwardsiella piscicida]
MNYTIEYYSEEVRLEVDQLPMGMRVRYQHLVERMEIYGSNLGEPHTSPFGDGLFELRIKGSDGIARVFYCTLTGKRIVML
HSFIKKTQKTPSAERKKAETRMKEVKHGW

Download         Length: 330 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11233.90 Da        Isoelectric Point: 8.5371

>AT273083 WP_005286394.1 NZ_CP118390:c1728106-1727798 [Edwardsiella piscicida]
MAGKRTPPTMTHDEMAAKWMEDPAFKAEYDAIEEEYALLDEMLAARKNAGLTQAQVAERMGTKPTAITRMESNLASGQSG
PSFATLKKFAHATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A411H7J1

Antitoxin

Source ID Structure

References