Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3663561..3664213 | Replicon | chromosome |
Accession | NZ_CP118269 | ||
Organism | Pantoea sp. Lij88 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PU624_RS21000 | Protein ID | WP_283546491.1 |
Coordinates | 3663561..3663917 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PU624_RS21005 | Protein ID | WP_283546492.1 |
Coordinates | 3663914..3664213 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU624_RS20985 (PU624_20985) | 3659289..3661073 | - | 1785 | WP_283546488.1 | GMC family oxidoreductase | - |
PU624_RS20990 (PU624_20990) | 3661076..3661810 | - | 735 | WP_283546489.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
PU624_RS20995 (PU624_20995) | 3662087..3663328 | + | 1242 | WP_283546490.1 | peptide antibiotic transporter SbmA | - |
PU624_RS21000 (PU624_21000) | 3663561..3663917 | + | 357 | WP_283546491.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PU624_RS21005 (PU624_21005) | 3663914..3664213 | + | 300 | WP_283546492.1 | XRE family transcriptional regulator | Antitoxin |
PU624_RS21010 (PU624_21010) | 3664371..3664580 | - | 210 | WP_283546493.1 | DUF1471 domain-containing protein | - |
PU624_RS21015 (PU624_21015) | 3664793..3665980 | - | 1188 | WP_283546494.1 | MFS transporter | - |
PU624_RS21020 (PU624_21020) | 3666086..3667051 | + | 966 | WP_283546495.1 | AraC family transcriptional regulator | - |
PU624_RS21025 (PU624_21025) | 3667048..3668592 | - | 1545 | WP_283546496.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13816.90 Da Isoelectric Point: 8.8339
>T272975 WP_283546491.1 NZ_CP118269:3663561-3663917 [Pantoea sp. Lij88]
MWTVLLSPRFESWLSEQEEALQEKMLADLGKLKVYGPDLPRPYADTLKGSQYKNMKELRVQFAGKPIRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADEEFSAWLAEQERKNNS
MWTVLLSPRFESWLSEQEEALQEKMLADLGKLKVYGPDLPRPYADTLKGSQYKNMKELRVQFAGKPIRAFYAFDPVRQAI
VLCAGDKSHDKRFYIRMIRIADEEFSAWLAEQERKNNS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|