Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2773376..2773980 | Replicon | chromosome |
Accession | NZ_CP118269 | ||
Organism | Pantoea sp. Lij88 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PU624_RS16785 | Protein ID | WP_283545891.1 |
Coordinates | 2773376..2773687 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PU624_RS16790 | Protein ID | WP_150012147.1 |
Coordinates | 2773687..2773980 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU624_RS16765 (PU624_16765) | 2768528..2769475 | - | 948 | WP_283545887.1 | ABC transporter ATP-binding protein | - |
PU624_RS16770 (PU624_16770) | 2769468..2770643 | - | 1176 | WP_283545888.1 | ABC transporter permease | - |
PU624_RS16775 (PU624_16775) | 2770647..2771558 | - | 912 | WP_283545889.1 | ABC transporter substrate-binding protein | - |
PU624_RS16780 (PU624_16780) | 2771845..2773320 | + | 1476 | WP_283545890.1 | MFS transporter | - |
PU624_RS16785 (PU624_16785) | 2773376..2773687 | + | 312 | WP_283545891.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PU624_RS16790 (PU624_16790) | 2773687..2773980 | + | 294 | WP_150012147.1 | NadS family protein | Antitoxin |
PU624_RS16795 (PU624_16795) | 2774155..2774697 | - | 543 | WP_283545892.1 | isopentenyl-diphosphate Delta-isomerase | - |
PU624_RS16800 (PU624_16800) | 2774844..2776739 | - | 1896 | WP_283545893.1 | methyl-accepting chemotaxis protein | - |
PU624_RS16805 (PU624_16805) | 2776930..2778039 | - | 1110 | WP_283545894.1 | suppressor of fused domain protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12088.82 Da Isoelectric Point: 8.3462
>T272972 WP_283545891.1 NZ_CP118269:2773376-2773687 [Pantoea sp. Lij88]
MLFIETPVFTEDVKELLSDDEYREFQQFMADNPYWGDVIQNTGGLRKVRWAAKGKGKRGGVRVIYYYKVSDSQIRLLLIY
KKGVQDDLSEDEKHLLRALNKGW
MLFIETPVFTEDVKELLSDDEYREFQQFMADNPYWGDVIQNTGGLRKVRWAAKGKGKRGGVRVIYYYKVSDSQIRLLLIY
KKGVQDDLSEDEKHLLRALNKGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|