Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
Location | 233246..233897 | Replicon | plasmid unnamed1 |
Accession | NZ_CP118267 | ||
Organism | Pantoea sp. Lij88 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PU624_RS01280 | Protein ID | WP_283545056.1 |
Coordinates | 233553..233897 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PU624_RS01275 | Protein ID | WP_283545055.1 |
Coordinates | 233246..233560 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU624_RS01250 (PU624_01250) | 229188..229490 | - | 303 | WP_283545050.1 | type 1 fimbrial protein | - |
PU624_RS01255 (PU624_01255) | 229962..230381 | - | 420 | WP_283545051.1 | VOC family protein | - |
PU624_RS01260 (PU624_01260) | 230399..231289 | - | 891 | WP_283545052.1 | LysR family transcriptional regulator | - |
PU624_RS01265 (PU624_01265) | 231429..232280 | + | 852 | WP_283545053.1 | Vmh family MBL fold metallo-hydrolase | - |
PU624_RS01270 (PU624_01270) | 232360..233031 | - | 672 | WP_283545054.1 | hypothetical protein | - |
PU624_RS01275 (PU624_01275) | 233246..233560 | - | 315 | WP_283545055.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
PU624_RS01280 (PU624_01280) | 233553..233897 | - | 345 | WP_283545056.1 | toxin | Toxin |
PU624_RS01285 (PU624_01285) | 233983..234885 | - | 903 | WP_283545057.1 | LysR family transcriptional regulator | - |
PU624_RS01290 (PU624_01290) | 234983..236041 | + | 1059 | WP_283545058.1 | SDR family oxidoreductase | - |
PU624_RS01295 (PU624_01295) | 236088..236966 | - | 879 | WP_283545059.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
PU624_RS01300 (PU624_01300) | 237070..237540 | - | 471 | WP_283545060.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..634148 | 634148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13429.35 Da Isoelectric Point: 9.7093
>T272968 WP_283545056.1 NZ_CP118267:c233897-233553 [Pantoea sp. Lij88]
MDALFIELSSFQKYRADYLSDDQFRLFQNMLLADPEKGDLIPDTGGLRKVRFRDERRHKGARGGIRVIYYWTNAQCQFIL
FTIYDKNLRDDLTKQQRDALATALNVIKKGLRHD
MDALFIELSSFQKYRADYLSDDQFRLFQNMLLADPEKGDLIPDTGGLRKVRFRDERRHKGARGGIRVIYYWTNAQCQFIL
FTIYDKNLRDDLTKQQRDALATALNVIKKGLRHD
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|