Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 5769842..5770542 | Replicon | chromosome |
Accession | NZ_CP118233 | ||
Organism | Micromonospora chalcea strain 1K05785M01 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | PVK74_RS26120 | Protein ID | WP_274477441.1 |
Coordinates | 5769842..5770234 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PVK74_RS26125 | Protein ID | WP_013284175.1 |
Coordinates | 5770231..5770542 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVK74_RS26100 (PVK74_26100) | 5765347..5766171 | + | 825 | WP_043326456.1 | ABC transporter permease | - |
PVK74_RS26105 (PVK74_26105) | 5766168..5767589 | + | 1422 | WP_043326455.1 | FAD-dependent oxidoreductase | - |
PVK74_RS26110 (PVK74_26110) | 5767589..5768791 | + | 1203 | WP_274477439.1 | saccharopine dehydrogenase C-terminal domain-containing protein | - |
PVK74_RS26115 (PVK74_26115) | 5768788..5769801 | + | 1014 | WP_274477440.1 | agmatinase | - |
PVK74_RS26120 (PVK74_26120) | 5769842..5770234 | + | 393 | WP_274477441.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVK74_RS26125 (PVK74_26125) | 5770231..5770542 | + | 312 | WP_013284175.1 | XRE family transcriptional regulator | Antitoxin |
PVK74_RS26130 (PVK74_26130) | 5770562..5771005 | - | 444 | WP_274477442.1 | hypothetical protein | - |
PVK74_RS26135 (PVK74_26135) | 5771103..5771450 | - | 348 | WP_043326443.1 | DUF779 domain-containing protein | - |
PVK74_RS26140 (PVK74_26140) | 5771450..5772955 | - | 1506 | WP_043326441.1 | aldehyde dehydrogenase family protein | - |
PVK74_RS26145 (PVK74_26145) | 5772996..5774279 | - | 1284 | WP_064447716.1 | hypothetical protein | - |
PVK74_RS26150 (PVK74_26150) | 5774515..5775180 | + | 666 | WP_043326436.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14833.80 Da Isoelectric Point: 10.2632
>T272966 WP_274477441.1 NZ_CP118233:5769842-5770234 [Micromonospora chalcea]
MGADGKRWSVRVTGEVRHWLRDLRDHDPASYESVRVAVDKLAEVGPGLGRPLVDTLRGSSLRNLKELRPRSGRDVAIWVL
FVFDPWSQAVLLVAGNKAGDWSRWYRQHIPAAEVAYKAWLDSERERRGES
MGADGKRWSVRVTGEVRHWLRDLRDHDPASYESVRVAVDKLAEVGPGLGRPLVDTLRGSSLRNLKELRPRSGRDVAIWVL
FVFDPWSQAVLLVAGNKAGDWSRWYRQHIPAAEVAYKAWLDSERERRGES
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|