Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 5115659..5116329 | Replicon | chromosome |
Accession | NZ_CP118233 | ||
Organism | Micromonospora chalcea strain 1K05785M01 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | A0A505H956 |
Locus tag | PVK74_RS22940 | Protein ID | WP_043330725.1 |
Coordinates | 5115659..5116012 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W7VGY7 |
Locus tag | PVK74_RS22945 | Protein ID | WP_043327344.1 |
Coordinates | 5116009..5116329 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVK74_RS22915 (PVK74_22915) | 5111080..5111400 | + | 321 | WP_043327353.1 | type VII secretion target | - |
PVK74_RS22920 (PVK74_22920) | 5111410..5112336 | + | 927 | WP_043327351.1 | WXG100 family type VII secretion target | - |
PVK74_RS22925 (PVK74_22925) | 5112346..5112699 | + | 354 | WP_043327350.1 | YbaB/EbfC family nucleoid-associated protein | - |
PVK74_RS22930 (PVK74_22930) | 5112704..5113303 | + | 600 | WP_274477179.1 | hypothetical protein | - |
PVK74_RS22935 (PVK74_22935) | 5113359..5115422 | - | 2064 | WP_043327346.1 | AAA family ATPase | - |
PVK74_RS22940 (PVK74_22940) | 5115659..5116012 | + | 354 | WP_043330725.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVK74_RS22945 (PVK74_22945) | 5116009..5116329 | + | 321 | WP_043327344.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PVK74_RS22950 (PVK74_22950) | 5116385..5116966 | + | 582 | WP_043327342.1 | winged helix-turn-helix domain-containing protein | - |
PVK74_RS22955 (PVK74_22955) | 5117007..5118248 | + | 1242 | WP_274477180.1 | MFS transporter | - |
PVK74_RS22960 (PVK74_22960) | 5118386..5119237 | + | 852 | WP_209959669.1 | menaquinone biosynthesis protein | - |
PVK74_RS22965 (PVK74_22965) | 5119282..5120217 | - | 936 | WP_274477181.1 | hypothetical protein | - |
PVK74_RS22970 (PVK74_22970) | 5120217..5121197 | - | 981 | WP_274477182.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13557.31 Da Isoelectric Point: 4.7878
>T272965 WP_043330725.1 NZ_CP118233:5115659-5116012 [Micromonospora chalcea]
MTGQVEDFLDELYAADRESHRLVNQAILVLERNGPIEGRPLVDSITASRLSNLKELRPPSAGRTEIRILFVFDPWRSAVL
LVAGDKSGQWTRWYRDAIPEAEQLYDTYLKERQEEIR
MTGQVEDFLDELYAADRESHRLVNQAILVLERNGPIEGRPLVDSITASRLSNLKELRPPSAGRTEIRILFVFDPWRSAVL
LVAGDKSGQWTRWYRDAIPEAEQLYDTYLKERQEEIR
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A505H956 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A505HF97 |