Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1951100..1951760 | Replicon | chromosome |
| Accession | NZ_CP118223 | ||
| Organism | Klebsiella grimontii strain YWC001 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PVK07_RS09220 | Protein ID | WP_049089248.1 |
| Coordinates | 1951100..1951453 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A9E1DQ94 |
| Locus tag | PVK07_RS09225 | Protein ID | WP_004132739.1 |
| Coordinates | 1951458..1951760 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK07_RS09195 (PVK07_09195) | 1946484..1947251 | - | 768 | WP_004132727.1 | molybdopterin-dependent oxidoreductase | - |
| PVK07_RS09200 (PVK07_09200) | 1947241..1947849 | - | 609 | WP_004132729.1 | cytochrome b/b6 domain-containing protein | - |
| PVK07_RS09205 (PVK07_09205) | 1947864..1948490 | - | 627 | WP_004132731.1 | hypothetical protein | - |
| PVK07_RS09210 (PVK07_09210) | 1948630..1949298 | + | 669 | WP_004132733.1 | heavy metal response regulator transcription factor | - |
| PVK07_RS09215 (PVK07_09215) | 1949298..1950716 | + | 1419 | WP_224250950.1 | heavy metal sensor histidine kinase | - |
| PVK07_RS09220 (PVK07_09220) | 1951100..1951453 | + | 354 | WP_049089248.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVK07_RS09225 (PVK07_09225) | 1951458..1951760 | + | 303 | WP_004132739.1 | XRE family transcriptional regulator | Antitoxin |
| PVK07_RS09230 (PVK07_09230) | 1951954..1952157 | + | 204 | Protein_1808 | hypothetical protein | - |
| PVK07_RS09235 (PVK07_09235) | 1952158..1952491 | + | 334 | Protein_1809 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PVK07_RS09245 (PVK07_09245) | 1952815..1954272 | + | 1458 | WP_224250915.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| PVK07_RS09255 (PVK07_09255) | 1955301..1956755 | - | 1455 | WP_024359975.1 | AMP nucleosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13639.64 Da Isoelectric Point: 9.8874
>T272947 WP_049089248.1 NZ_CP118223:1951100-1951453 [Klebsiella grimontii]
VWMIKTTDTFERWFTSLNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
VWMIKTTDTFERWFTSLNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|