Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 42968..43618 | Replicon | chromosome |
Accession | NZ_CP118223 | ||
Organism | Klebsiella grimontii strain YWC001 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9E1GCI7 |
Locus tag | PVK07_RS00210 | Protein ID | WP_024360564.1 |
Coordinates | 42968..43309 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A9E1GGB7 |
Locus tag | PVK07_RS00215 | Protein ID | WP_024360565.1 |
Coordinates | 43319..43618 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVK07_RS00195 (PVK07_00195) | 39201..40520 | + | 1320 | WP_004133107.1 | MFS transporter | - |
PVK07_RS00200 (PVK07_00200) | 40666..42057 | + | 1392 | WP_004126843.1 | hexose-6-phosphate:phosphate antiporter | - |
PVK07_RS00205 (PVK07_00205) | 42269..42721 | + | 453 | WP_049087028.1 | DUF1198 domain-containing protein | - |
PVK07_RS00210 (PVK07_00210) | 42968..43309 | + | 342 | WP_024360564.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVK07_RS00215 (PVK07_00215) | 43319..43618 | + | 300 | WP_024360565.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PVK07_RS00220 (PVK07_00220) | 43736..44917 | + | 1182 | WP_082237945.1 | purine ribonucleoside efflux pump NepI | - |
PVK07_RS00225 (PVK07_00225) | 45036..46415 | - | 1380 | WP_004133118.1 | carbohydrate porin | - |
PVK07_RS00230 (PVK07_00230) | 46518..46820 | - | 303 | WP_004855598.1 | PTS lactose/cellobiose transporter subunit IIA | - |
PVK07_RS00235 (PVK07_00235) | 46928..48253 | - | 1326 | WP_004133122.1 | PTS sugar transporter subunit IIC | - |
PVK07_RS00240 (PVK07_00240) | 48265..48576 | - | 312 | WP_004133123.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13091.97 Da Isoelectric Point: 5.7558
>T272942 WP_024360564.1 NZ_CP118223:42968-43309 [Klebsiella grimontii]
MWDVETTEVFDKWFEAQIEALKEDMLAAMVILSEYGPQLGRPFADTVNDSAFSNMKELRVQHRGSPIRAFFVFDPSRRGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
MWDVETTEVFDKWFEAQIEALKEDMLAAMVILSEYGPQLGRPFADTVNDSAFSNMKELRVQHRGSPIRAFFVFDPSRRGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|