Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrE/- |
| Location | 2234716..2234978 | Replicon | chromosome |
| Accession | NZ_CP118167 | ||
| Organism | Bacillus subtilis strain 21855 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | PUW21_RS11485 | Protein ID | WP_009967548.1 |
| Coordinates | 2234716..2234832 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 2234827..2234978 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW21_RS11445 (2229806) | 2229806..2230057 | + | 252 | WP_061891069.1 | phage holin | - |
| PUW21_RS11450 (2230185) | 2230185..2231321 | + | 1137 | WP_019712879.1 | tetratricopeptide repeat protein | - |
| PUW21_RS11455 (2231311) | 2231311..2231487 | + | 177 | WP_061891068.1 | hypothetical protein | - |
| PUW21_RS11460 (2231529) | 2231529..2232779 | - | 1251 | WP_274357910.1 | UV damage repair protein UvrX | - |
| PUW21_RS11465 (2232772) | 2232772..2233104 | - | 333 | WP_061891067.1 | YolD-like family protein | - |
| PUW21_RS11470 (2233277) | 2233277..2233612 | + | 336 | WP_041336417.1 | hypothetical protein | - |
| PUW21_RS11475 (2233655) | 2233655..2234011 | - | 357 | WP_072566416.1 | hypothetical protein | - |
| PUW21_RS11480 (2234017) | 2234017..2234484 | - | 468 | WP_041336414.1 | YolA family protein | - |
| PUW21_RS11485 (2234716) | 2234716..2234832 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2234827) | 2234827..2234978 | - | 152 | NuclAT_1 | - | Antitoxin |
| - (2234827) | 2234827..2234978 | - | 152 | NuclAT_1 | - | Antitoxin |
| - (2234827) | 2234827..2234978 | - | 152 | NuclAT_1 | - | Antitoxin |
| - (2234827) | 2234827..2234978 | - | 152 | NuclAT_1 | - | Antitoxin |
| PUW21_RS11490 (2235149) | 2235149..2235646 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| PUW21_RS11495 (2235655) | 2235655..2237370 | - | 1716 | WP_274357911.1 | ribonuclease YeeF family protein | - |
| PUW21_RS11500 (2237622) | 2237622..2238623 | + | 1002 | WP_250620705.1 | hypothetical protein | - |
| PUW21_RS11505 (2238657) | 2238657..2239193 | - | 537 | WP_213377332.1 | SMI1/KNR4 family protein | - |
| PUW21_RS11510 (2239280) | 2239280..2239531 | - | 252 | WP_213377330.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2120487..2245041 | 124554 | |
| - | inside | Prophage | - | - | 2120487..2243085 | 122598 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T272938 WP_009967548.1 NZ_CP118167:2234716-2234832 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 152 bp
>AT272938 NZ_CP118167:c2234978-2234827 [Bacillus subtilis]
TTTCTTTAATGAGAAATGCATAAAATAAAAAGACCAGGGTGTTGGCGCACCCCGGCTCTGTACAAAAAGCTGCCCGTCAA
AGGGCTTACTCGATGTTCAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
TTTCTTTAATGAGAAATGCATAAAATAAAAAGACCAGGGTGTTGGCGCACCCCGGCTCTGTACAAAAAGCTGCCCGTCAA
AGGGCTTACTCGATGTTCAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
