Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) bsrG-as-bsrE/-
Location 2234716..2234979 Replicon chromosome
Accession NZ_CP118167
Organism Bacillus subtilis strain 21855

Toxin (Protein)


Gene name bsrG Uniprot ID L8EAY0
Locus tag PUW21_RS11485 Protein ID WP_009967548.1
Coordinates 2234716..2234832 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name as-bsrE
Locus tag -
Coordinates 2234824..2234979 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW21_RS11445 2229806..2230057 + 252 WP_061891069.1 phage holin -
PUW21_RS11450 2230185..2231321 + 1137 WP_019712879.1 tetratricopeptide repeat protein -
PUW21_RS11455 2231311..2231487 + 177 WP_061891068.1 hypothetical protein -
PUW21_RS11460 2231529..2232779 - 1251 WP_274357910.1 UV damage repair protein UvrX -
PUW21_RS11465 2232772..2233104 - 333 WP_061891067.1 YolD-like family protein -
PUW21_RS11470 2233277..2233612 + 336 WP_041336417.1 hypothetical protein -
PUW21_RS11475 2233655..2234011 - 357 WP_072566416.1 hypothetical protein -
PUW21_RS11480 2234017..2234484 - 468 WP_041336414.1 YolA family protein -
PUW21_RS11485 2234716..2234832 + 117 WP_009967548.1 type I toxin-antitoxin system toxin BsrG Toxin
- 2234824..2234979 - 156 - - Antitoxin
PUW21_RS11490 2235149..2235646 - 498 WP_003246188.1 SMI1/KNR4 family protein -
PUW21_RS11495 2235655..2237370 - 1716 WP_274357911.1 ribonuclease YeeF family protein -
PUW21_RS11500 2237622..2238623 + 1002 WP_250620705.1 hypothetical protein -
PUW21_RS11505 2238657..2239193 - 537 WP_213377332.1 SMI1/KNR4 family protein -
PUW21_RS11510 2239280..2239531 - 252 WP_213377330.1 PH domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2120487..2245041 124554
- inside Prophage - - 2120487..2243085 122598


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(1-38)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4336.39 Da        Isoelectric Point: 10.1022

>T272936 WP_009967548.1 NZ_CP118167:2234716-2234832 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Download         Length: 117 bp

Antitoxin


Download         Length: 156 bp

>AT272936 NZ_CP118167:c2234979-2234824 [Bacillus subtilis]
ATTTCTTTAATGAGAAATGCATAAAATAAAAAGACCAGGGTGTTGGCGCACCCCGGCTCTGTACAAAAAGCTGCCCGTCA
AAGGGCTTACTCGATGTTCAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7EVU9

Antitoxin

Download structure file

References