Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-as-bsrE/- |
| Location | 2186877..2187094 | Replicon | chromosome |
| Accession | NZ_CP118167 | ||
| Organism | Bacillus subtilis strain 21855 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | A0A6H0WKE8 |
| Locus tag | PUW21_RS11235 | Protein ID | WP_032721653.1 |
| Coordinates | 2186877..2187053 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 2186994..2187094 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW21_RS11185 (2182549) | 2182549..2182776 | - | 228 | WP_059293799.1 | helix-turn-helix transcriptional regulator | - |
| PUW21_RS11190 (2183007) | 2183007..2183318 | - | 312 | WP_059293798.1 | hypothetical protein | - |
| PUW21_RS11195 (2183446) | 2183446..2183772 | - | 327 | WP_059293797.1 | hypothetical protein | - |
| PUW21_RS11200 (2183787) | 2183787..2184062 | - | 276 | WP_059293796.1 | hypothetical protein | - |
| PUW21_RS11205 (2184088) | 2184088..2184312 | - | 225 | WP_226465935.1 | hypothetical protein | - |
| PUW21_RS11210 (2184305) | 2184305..2184436 | - | 132 | WP_268396230.1 | hypothetical protein | - |
| PUW21_RS11215 (2184484) | 2184484..2184738 | - | 255 | WP_032677190.1 | hypothetical protein | - |
| PUW21_RS11220 (2185079) | 2185079..2186296 | - | 1218 | WP_160245139.1 | hypothetical protein | - |
| PUW21_RS11225 (2186378) | 2186378..2186566 | - | 189 | WP_114168610.1 | hypothetical protein | - |
| PUW21_RS11230 (2186611) | 2186611..2186862 | - | 252 | WP_080010576.1 | hypothetical protein | - |
| PUW21_RS11235 (2186877) | 2186877..2187053 | - | 177 | WP_032721653.1 | hypothetical protein | Toxin |
| - (2186994) | 2186994..2187094 | + | 101 | NuclAT_0 | - | Antitoxin |
| - (2186994) | 2186994..2187094 | + | 101 | NuclAT_0 | - | Antitoxin |
| - (2186994) | 2186994..2187094 | + | 101 | NuclAT_0 | - | Antitoxin |
| - (2186994) | 2186994..2187094 | + | 101 | NuclAT_0 | - | Antitoxin |
| PUW21_RS11240 (2188079) | 2188079..2188273 | + | 195 | WP_004399291.1 | hypothetical protein | - |
| PUW21_RS11245 (2188313) | 2188313..2190838 | + | 2526 | WP_274357892.1 | hypothetical protein | - |
| PUW21_RS11250 (2191091) | 2191091..2191366 | + | 276 | WP_032721646.1 | HU family DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2120487..2245041 | 124554 | |
| - | inside | Prophage | - | - | 2120487..2243085 | 122598 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6850.39 Da Isoelectric Point: 12.8833
>T272932 WP_032721653.1 NZ_CP118167:c2187053-2186877 [Bacillus subtilis]
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT272932 NZ_CP118167:2186994-2187094 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
