Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 1161518..1162168 | Replicon | chromosome |
| Accession | NZ_CP118165 | ||
| Organism | Glaesserella parasuis strain XP11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1S9ZYD2 |
| Locus tag | PUV55_RS05640 | Protein ID | WP_021115585.1 |
| Coordinates | 1161518..1161856 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PUV55_RS05645 | Protein ID | WP_005710405.1 |
| Coordinates | 1161860..1162168 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUV55_RS05595 (PUV55_05595) | 1157088..1157462 | + | 375 | WP_010786049.1 | cytochrome b562 | - |
| PUV55_RS05600 (PUV55_05600) | 1157602..1158536 | + | 935 | Protein_1105 | IS256 family transposase | - |
| PUV55_RS05605 (PUV55_05605) | 1158491..1158757 | + | 267 | Protein_1106 | cation-transporting ATPase PacS | - |
| PUV55_RS05615 (PUV55_05615) | 1159240..1160679 | - | 1440 | WP_005710409.1 | glutamate--tRNA ligase | - |
| PUV55_RS05640 (PUV55_05640) | 1161518..1161856 | + | 339 | WP_021115585.1 | selenocysteine synthase | Toxin |
| PUV55_RS05645 (PUV55_05645) | 1161860..1162168 | + | 309 | WP_005710405.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PUV55_RS05650 (PUV55_05650) | 1162369..1163529 | + | 1161 | WP_005710403.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| PUV55_RS05655 (PUV55_05655) | 1163629..1164210 | + | 582 | WP_021110392.1 | type IV pilus biogenesis/stability protein PilW | - |
| PUV55_RS05660 (PUV55_05660) | 1164271..1165206 | + | 936 | WP_005710401.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| PUV55_RS05665 (PUV55_05665) | 1165206..1165694 | + | 489 | WP_005710400.1 | transcription elongation factor GreB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1157602..1158141 | 539 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13258.29 Da Isoelectric Point: 10.0084
>T272920 WP_021115585.1 NZ_CP118165:1161518-1161856 [Glaesserella parasuis]
MNVAFVELPPFEEYRKKYLDDDSFRLLQNELLKFPDKGELIQGTGGLRKLRIVDIIRQKGKRGGARVIYYYYVRGKQVWL
FHAYNKNQQDDLSNEERVVLANTLSYLKSLVR
MNVAFVELPPFEEYRKKYLDDDSFRLLQNELLKFPDKGELIQGTGGLRKLRIVDIIRQKGKRGGARVIYYYYVRGKQVWL
FHAYNKNQQDDLSNEERVVLANTLSYLKSLVR
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|