Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 389438..390081 | Replicon | chromosome |
| Accession | NZ_CP118165 | ||
| Organism | Glaesserella parasuis strain XP11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PUV55_RS01965 | Protein ID | WP_021113598.1 |
| Coordinates | 389438..389782 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PUV55_RS01970 | Protein ID | WP_160440844.1 |
| Coordinates | 389785..390081 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUV55_RS01950 (PUV55_01950) | 385152..385556 | - | 405 | WP_274359965.1 | hypothetical protein | - |
| PUV55_RS01955 (PUV55_01955) | 386043..387134 | - | 1092 | WP_005714201.1 | murein transglycosylase A | - |
| PUV55_RS01960 (PUV55_01960) | 387245..389224 | - | 1980 | WP_160429074.1 | exoribonuclease II | - |
| PUV55_RS01965 (PUV55_01965) | 389438..389782 | + | 345 | WP_021113598.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUV55_RS01970 (PUV55_01970) | 389785..390081 | + | 297 | WP_160440844.1 | NadS family protein | Antitoxin |
| PUV55_RS01975 (PUV55_01975) | 390138..391100 | + | 963 | WP_026917107.1 | WYL domain-containing protein | - |
| PUV55_RS01980 (PUV55_01980) | 391176..391949 | + | 774 | WP_035519505.1 | PD-(D/E)XK nuclease family protein | - |
| PUV55_RS01985 (PUV55_01985) | 391966..392613 | + | 648 | WP_016527812.1 | hypothetical protein | - |
| PUV55_RS01990 (PUV55_01990) | 392892..393608 | + | 717 | WP_016527813.1 | cell division protein FtsZ | - |
| PUV55_RS01995 (PUV55_01995) | 393653..394622 | + | 970 | Protein_390 | IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13277.25 Da Isoelectric Point: 5.9233
>T272917 WP_021113598.1 NZ_CP118165:389438-389782 [Glaesserella parasuis]
METEEYLTFIETKIFEEDRKALMSDDEYQKFQAYLLESHELGDFIQNTGGCQKIRWKLESNNKGKSGGVRVIYYVVTKQG
KLLLMMMYAKSKQDNMSDKQKAMLKAVVSQLSEE
METEEYLTFIETKIFEEDRKALMSDDEYQKFQAYLLESHELGDFIQNTGGCQKIRWKLESNNKGKSGGVRVIYYVVTKQG
KLLLMMMYAKSKQDNMSDKQKAMLKAVVSQLSEE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|