Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 4784484..4785138 | Replicon | chromosome |
| Accession | NZ_CP118155 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 17411 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PUP78_RS21495 | Protein ID | WP_124324922.1 |
| Coordinates | 4784484..4784834 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PUP78_RS21500 | Protein ID | WP_124324923.1 |
| Coordinates | 4784824..4785138 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP78_RS21485 (PUP78_21485) | 4781235..4782767 | + | 1533 | WP_053279911.1 | NADH-quinone oxidoreductase subunit M | - |
| PUP78_RS21490 (PUP78_21490) | 4782775..4784238 | + | 1464 | WP_009049791.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| PUP78_RS21495 (PUP78_21495) | 4784484..4784834 | + | 351 | WP_124324922.1 | toxin | Toxin |
| PUP78_RS21500 (PUP78_21500) | 4784824..4785138 | + | 315 | WP_124324923.1 | transcriptional regulator | Antitoxin |
| PUP78_RS21505 (PUP78_21505) | 4785316..4787058 | - | 1743 | WP_025804713.1 | ABC transporter substrate-binding protein | - |
| PUP78_RS21510 (PUP78_21510) | 4787109..4787381 | - | 273 | WP_025804714.1 | DUF2160 domain-containing protein | - |
| PUP78_RS21515 (PUP78_21515) | 4787392..4788192 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
| PUP78_RS21520 (PUP78_21520) | 4788204..4789070 | - | 867 | WP_124324924.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13791.76 Da Isoelectric Point: 9.4187
>T272902 WP_124324922.1 NZ_CP118155:4784484-4784834 [Pseudomonas chlororaphis]
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|