Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2698076..2698662 | Replicon | chromosome |
Accession | NZ_CP118153 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17811 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | PUP50_RS12500 | Protein ID | WP_274306201.1 |
Coordinates | 2698384..2698662 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | PUP50_RS12495 | Protein ID | WP_274306200.1 |
Coordinates | 2698076..2698375 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP50_RS12470 (PUP50_12470) | 2695479..2695817 | + | 339 | WP_274306195.1 | phage tail protein | - |
PUP50_RS12475 (PUP50_12475) | 2695827..2696576 | + | 750 | WP_274306196.1 | phage minor tail protein L | - |
PUP50_RS12480 (PUP50_12480) | 2696579..2697343 | + | 765 | WP_274306197.1 | C40 family peptidase | - |
PUP50_RS12485 (PUP50_12485) | 2697369..2697533 | + | 165 | WP_274306198.1 | hypothetical protein | - |
PUP50_RS12490 (PUP50_12490) | 2697526..2697765 | - | 240 | WP_274306199.1 | hypothetical protein | - |
PUP50_RS12495 (PUP50_12495) | 2698076..2698375 | - | 300 | WP_274306200.1 | HigA family addiction module antitoxin | Antitoxin |
PUP50_RS12500 (PUP50_12500) | 2698384..2698662 | - | 279 | WP_274306201.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP50_RS12505 (PUP50_12505) | 2698807..2699229 | + | 423 | WP_274306202.1 | hypothetical protein | - |
PUP50_RS12510 (PUP50_12510) | 2699272..2699880 | + | 609 | WP_274306203.1 | tail assembly protein | - |
PUP50_RS12515 (PUP50_12515) | 2699916..2700179 | + | 264 | WP_274306204.1 | hypothetical protein | - |
PUP50_RS12520 (PUP50_12520) | 2700163..2700393 | - | 231 | WP_274306205.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2653426..2762588 | 109162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10555.89 Da Isoelectric Point: 6.7108
>T272887 WP_274306201.1 NZ_CP118153:c2698662-2698384 [Pseudomonas chlororaphis]
MIRSFACADTEALFTTGRTRRWADIKSVAERKLAALDAAKELRDLRSPPGNRLHSLEGDREGQHSISINMQWRVCFIWTE
NGPENVEIVDYH
MIRSFACADTEALFTTGRTRRWADIKSVAERKLAALDAAKELRDLRSPPGNRLHSLEGDREGQHSISINMQWRVCFIWTE
NGPENVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|