Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4770215..4770869 | Replicon | chromosome |
Accession | NZ_CP118150 | ||
Organism | Pseudomonas chlororaphis strain DSM 21509 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PUP49_RS21335 | Protein ID | WP_231998601.1 |
Coordinates | 4770215..4770565 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUP49_RS21340 | Protein ID | WP_053279913.1 |
Coordinates | 4770555..4770869 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP49_RS21325 (PUP49_21325) | 4766965..4768497 | + | 1533 | WP_053279911.1 | NADH-quinone oxidoreductase subunit M | - |
PUP49_RS21330 (PUP49_21330) | 4768505..4769968 | + | 1464 | WP_007929613.1 | NADH-quinone oxidoreductase subunit NuoN | - |
PUP49_RS21335 (PUP49_21335) | 4770215..4770565 | + | 351 | WP_231998601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP49_RS21340 (PUP49_21340) | 4770555..4770869 | + | 315 | WP_053279913.1 | XRE family transcriptional regulator | Antitoxin |
PUP49_RS21345 (PUP49_21345) | 4771046..4772788 | - | 1743 | WP_053261847.1 | ABC transporter substrate-binding protein | - |
PUP49_RS21350 (PUP49_21350) | 4772839..4773111 | - | 273 | WP_053279914.1 | DUF2160 domain-containing protein | - |
PUP49_RS21355 (PUP49_21355) | 4773122..4773922 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
PUP49_RS21360 (PUP49_21360) | 4773934..4774800 | - | 867 | WP_053279915.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13859.83 Da Isoelectric Point: 9.3419
>T272873 WP_231998601.1 NZ_CP118150:4770215-4770565 [Pseudomonas chlororaphis]
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGSAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGSAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|