Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4672341..4672995 | Replicon | chromosome |
Accession | NZ_CP118149 | ||
Organism | Pseudomonas chlororaphis strain NCCB 60037 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A554PC23 |
Locus tag | PUP59_RS21080 | Protein ID | WP_041986396.1 |
Coordinates | 4672341..4672691 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUP59_RS21085 | Protein ID | WP_016701900.1 |
Coordinates | 4672681..4672995 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP59_RS21070 (PUP59_21070) | 4669091..4670623 | + | 1533 | WP_009049790.1 | NADH-quinone oxidoreductase subunit M | - |
PUP59_RS21075 (PUP59_21075) | 4670631..4672094 | + | 1464 | WP_009049791.1 | NADH-quinone oxidoreductase subunit NuoN | - |
PUP59_RS21080 (PUP59_21080) | 4672341..4672691 | + | 351 | WP_041986396.1 | toxin | Toxin |
PUP59_RS21085 (PUP59_21085) | 4672681..4672995 | + | 315 | WP_016701900.1 | transcriptional regulator | Antitoxin |
PUP59_RS21090 (PUP59_21090) | 4673162..4674904 | - | 1743 | WP_023964376.1 | ABC transporter substrate-binding protein | - |
PUP59_RS21095 (PUP59_21095) | 4675068..4675340 | - | 273 | WP_009049795.1 | DUF2160 domain-containing protein | - |
PUP59_RS21100 (PUP59_21100) | 4675351..4676151 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
PUP59_RS21105 (PUP59_21105) | 4676163..4677029 | - | 867 | WP_041986252.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13861.80 Da Isoelectric Point: 8.5032
>T272866 WP_041986396.1 NZ_CP118149:4672341-4672691 [Pseudomonas chlororaphis]
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGTDGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGTDGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|