Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 4633287..4633941 | Replicon | chromosome |
| Accession | NZ_CP118148 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 880622 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A554PC23 |
| Locus tag | PUP58_RS20710 | Protein ID | WP_041986396.1 |
| Coordinates | 4633287..4633637 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PUP58_RS20715 | Protein ID | WP_016701900.1 |
| Coordinates | 4633627..4633941 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP58_RS20700 (PUP58_20700) | 4630037..4631569 | + | 1533 | WP_009049790.1 | NADH-quinone oxidoreductase subunit M | - |
| PUP58_RS20705 (PUP58_20705) | 4631577..4633040 | + | 1464 | WP_009049791.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| PUP58_RS20710 (PUP58_20710) | 4633287..4633637 | + | 351 | WP_041986396.1 | toxin | Toxin |
| PUP58_RS20715 (PUP58_20715) | 4633627..4633941 | + | 315 | WP_016701900.1 | transcriptional regulator | Antitoxin |
| PUP58_RS20720 (PUP58_20720) | 4634108..4635850 | - | 1743 | WP_023964376.1 | ABC transporter substrate-binding protein | - |
| PUP58_RS20725 (PUP58_20725) | 4636014..4636286 | - | 273 | WP_009049795.1 | DUF2160 domain-containing protein | - |
| PUP58_RS20730 (PUP58_20730) | 4636297..4637097 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
| PUP58_RS20735 (PUP58_20735) | 4637109..4637975 | - | 867 | WP_274319037.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13861.80 Da Isoelectric Point: 8.5032
>T272859 WP_041986396.1 NZ_CP118148:4633287-4633637 [Pseudomonas chlororaphis]
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGTDGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGTDGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|