Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 2784867..2785521 | Replicon | chromosome |
Accession | NZ_CP118142 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17809 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PUP81_RS12810 | Protein ID | WP_124324922.1 |
Coordinates | 2785171..2785521 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUP81_RS12805 | Protein ID | WP_124324923.1 |
Coordinates | 2784867..2785181 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP81_RS12785 (PUP81_12785) | 2780935..2781801 | + | 867 | WP_124324924.1 | sugar ABC transporter permease | - |
PUP81_RS12790 (PUP81_12790) | 2781813..2782613 | + | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
PUP81_RS12795 (PUP81_12795) | 2782624..2782896 | + | 273 | WP_025804714.1 | DUF2160 domain-containing protein | - |
PUP81_RS12800 (PUP81_12800) | 2782947..2784689 | + | 1743 | WP_025804713.1 | ABC transporter substrate-binding protein | - |
PUP81_RS12805 (PUP81_12805) | 2784867..2785181 | - | 315 | WP_124324923.1 | transcriptional regulator | Antitoxin |
PUP81_RS12810 (PUP81_12810) | 2785171..2785521 | - | 351 | WP_124324922.1 | toxin | Toxin |
PUP81_RS12815 (PUP81_12815) | 2785767..2787230 | - | 1464 | WP_009049791.1 | NADH-quinone oxidoreductase subunit NuoN | - |
PUP81_RS12820 (PUP81_12820) | 2787238..2788770 | - | 1533 | WP_053279911.1 | NADH-quinone oxidoreductase subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13791.76 Da Isoelectric Point: 9.4187
>T272812 WP_124324922.1 NZ_CP118142:c2785521-2785171 [Pseudomonas chlororaphis]
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|