Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/- |
| Location | 4932145..4932799 | Replicon | chromosome |
| Accession | NZ_CP118139 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295781 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PUP68_RS22045 | Protein ID | WP_231998601.1 |
| Coordinates | 4932145..4932495 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PUP68_RS22050 | Protein ID | WP_053279913.1 |
| Coordinates | 4932485..4932799 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP68_RS22035 (PUP68_22035) | 4928895..4930427 | + | 1533 | WP_053279911.1 | NADH-quinone oxidoreductase subunit M | - |
| PUP68_RS22040 (PUP68_22040) | 4930435..4931898 | + | 1464 | WP_007929613.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| PUP68_RS22045 (PUP68_22045) | 4932145..4932495 | + | 351 | WP_231998601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP68_RS22050 (PUP68_22050) | 4932485..4932799 | + | 315 | WP_053279913.1 | XRE family transcriptional regulator | Antitoxin |
| PUP68_RS22055 (PUP68_22055) | 4932976..4934718 | - | 1743 | WP_274319878.1 | ABC transporter substrate-binding protein | - |
| PUP68_RS22060 (PUP68_22060) | 4934769..4935041 | - | 273 | WP_053279914.1 | DUF2160 domain-containing protein | - |
| PUP68_RS22065 (PUP68_22065) | 4935052..4935852 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
| PUP68_RS22070 (PUP68_22070) | 4935864..4936730 | - | 867 | WP_053279915.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13859.83 Da Isoelectric Point: 9.3419
>T272798 WP_231998601.1 NZ_CP118139:4932145-4932495 [Pseudomonas chlororaphis]
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGSAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGSAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|