Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4931194..4931848 | Replicon | chromosome |
Accession | NZ_CP118138 | ||
Organism | Pseudomonas chlororaphis strain DSM 295782 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PUP77_RS22815 | Protein ID | WP_231998601.1 |
Coordinates | 4931498..4931848 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUP77_RS22810 | Protein ID | WP_053279913.1 |
Coordinates | 4931194..4931508 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP77_RS22790 (PUP77_22790) | 4927263..4928129 | + | 867 | WP_053279915.1 | sugar ABC transporter permease | - |
PUP77_RS22795 (PUP77_22795) | 4928141..4928941 | + | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
PUP77_RS22800 (PUP77_22800) | 4928952..4929224 | + | 273 | WP_053279914.1 | DUF2160 domain-containing protein | - |
PUP77_RS22805 (PUP77_22805) | 4929275..4931017 | + | 1743 | WP_274319878.1 | ABC transporter substrate-binding protein | - |
PUP77_RS22810 (PUP77_22810) | 4931194..4931508 | - | 315 | WP_053279913.1 | XRE family transcriptional regulator | Antitoxin |
PUP77_RS22815 (PUP77_22815) | 4931498..4931848 | - | 351 | WP_231998601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP77_RS22820 (PUP77_22820) | 4932095..4933558 | - | 1464 | WP_007929613.1 | NADH-quinone oxidoreductase subunit NuoN | - |
PUP77_RS22825 (PUP77_22825) | 4933566..4935098 | - | 1533 | WP_053279911.1 | NADH-quinone oxidoreductase subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13859.83 Da Isoelectric Point: 9.3419
>T272791 WP_231998601.1 NZ_CP118138:c4931848-4931498 [Pseudomonas chlororaphis]
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGSAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGSAQFWL
FTLYAKNEQNDLTPHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|