Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4787123..4787777 | Replicon | chromosome |
Accession | NZ_CP118137 | ||
Organism | Pseudomonas chlororaphis strain NCCB 47033 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PUP65_RS21510 | Protein ID | WP_124324922.1 |
Coordinates | 4787123..4787473 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUP65_RS21515 | Protein ID | WP_124324923.1 |
Coordinates | 4787463..4787777 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP65_RS21500 (PUP65_21500) | 4783874..4785406 | + | 1533 | WP_053279911.1 | NADH-quinone oxidoreductase subunit M | - |
PUP65_RS21505 (PUP65_21505) | 4785414..4786877 | + | 1464 | WP_009049791.1 | NADH-quinone oxidoreductase subunit NuoN | - |
PUP65_RS21510 (PUP65_21510) | 4787123..4787473 | + | 351 | WP_124324922.1 | toxin | Toxin |
PUP65_RS21515 (PUP65_21515) | 4787463..4787777 | + | 315 | WP_124324923.1 | transcriptional regulator | Antitoxin |
PUP65_RS21520 (PUP65_21520) | 4787955..4789697 | - | 1743 | WP_025804713.1 | ABC transporter substrate-binding protein | - |
PUP65_RS21525 (PUP65_21525) | 4789748..4790020 | - | 273 | WP_025804714.1 | DUF2160 domain-containing protein | - |
PUP65_RS21530 (PUP65_21530) | 4790031..4790831 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
PUP65_RS21535 (PUP65_21535) | 4790843..4791709 | - | 867 | WP_124324924.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13791.76 Da Isoelectric Point: 9.4187
>T272787 WP_124324922.1 NZ_CP118137:4787123-4787473 [Pseudomonas chlororaphis]
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRHRQDYLDDELFRSLQLELLKAPEAGDLIEGVGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQNDLTSHQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|