Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 3898328..3898982 | Replicon | chromosome |
Accession | NZ_CP118134 | ||
Organism | Pseudomonas synxantha strain ATCC 17413 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PUP72_RS17480 | Protein ID | WP_046068644.1 |
Coordinates | 3898328..3898678 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0W0N117 |
Locus tag | PUP72_RS17485 | Protein ID | WP_014718915.1 |
Coordinates | 3898668..3898982 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP72_RS17470 (PUP72_17470) | 3895087..3896619 | + | 1533 | WP_034120261.1 | NADH-quinone oxidoreductase subunit M | - |
PUP72_RS17475 (PUP72_17475) | 3896627..3898090 | + | 1464 | WP_043046579.1 | NADH-quinone oxidoreductase subunit NuoN | - |
PUP72_RS17480 (PUP72_17480) | 3898328..3898678 | + | 351 | WP_046068644.1 | toxin | Toxin |
PUP72_RS17485 (PUP72_17485) | 3898668..3898982 | + | 315 | WP_014718915.1 | XRE family transcriptional regulator | Antitoxin |
PUP72_RS17490 (PUP72_17490) | 3899042..3899794 | - | 753 | WP_274354886.1 | outer membrane beta-barrel protein | - |
PUP72_RS17495 (PUP72_17495) | 3899920..3900753 | - | 834 | WP_274354887.1 | arylamine N-acetyltransferase | - |
PUP72_RS17500 (PUP72_17500) | 3900872..3901108 | + | 237 | WP_005789137.1 | hypothetical protein | - |
PUP72_RS17505 (PUP72_17505) | 3901139..3901345 | - | 207 | WP_046068647.1 | DUF6021 family protein | - |
PUP72_RS17510 (PUP72_17510) | 3901358..3901537 | - | 180 | WP_046068648.1 | hypothetical protein | - |
PUP72_RS17515 (PUP72_17515) | 3901652..3902173 | + | 522 | WP_046068649.1 | DUF3087 family protein | - |
PUP72_RS17520 (PUP72_17520) | 3902181..3903311 | - | 1131 | WP_046068650.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13794.71 Da Isoelectric Point: 9.7336
>T272762 WP_046068644.1 NZ_CP118134:3898328-3898678 [Pseudomonas synxantha]
MDALFIELPAFERHRKDYLSEELFQGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEHSDLTPHHKKALKHMLDREIKARTHHET
MDALFIELPAFERHRKDYLSEELFQGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEHSDLTPHHKKALKHMLDREIKARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|