Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1826317..1826921 | Replicon | chromosome |
Accession | NZ_CP118134 | ||
Organism | Pseudomonas synxantha strain ATCC 17413 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PUP72_RS08225 | Protein ID | WP_046071432.1 |
Coordinates | 1826607..1826921 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PUP72_RS08220 | Protein ID | WP_003189536.1 |
Coordinates | 1826317..1826604 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP72_RS08185 (PUP72_08185) | 1822079..1822792 | + | 714 | WP_010212191.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PUP72_RS08195 (PUP72_08195) | 1823087..1823482 | + | 396 | WP_046071429.1 | nucleotidyltransferase domain-containing protein | - |
PUP72_RS08200 (PUP72_08200) | 1823472..1823891 | + | 420 | WP_274358134.1 | DUF86 domain-containing protein | - |
PUP72_RS08205 (PUP72_08205) | 1823924..1824004 | - | 81 | Protein_1614 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
PUP72_RS08210 (PUP72_08210) | 1824527..1824778 | + | 252 | WP_005786036.1 | hypothetical protein | - |
PUP72_RS08215 (PUP72_08215) | 1824852..1826078 | - | 1227 | WP_059397051.1 | MFS transporter | - |
PUP72_RS08220 (PUP72_08220) | 1826317..1826604 | - | 288 | WP_003189536.1 | NadS family protein | Antitoxin |
PUP72_RS08225 (PUP72_08225) | 1826607..1826921 | - | 315 | WP_046071432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP72_RS08230 (PUP72_08230) | 1827027..1827968 | - | 942 | WP_274358135.1 | LysR family transcriptional regulator | - |
PUP72_RS08235 (PUP72_08235) | 1828126..1829442 | + | 1317 | WP_068966592.1 | MFS transporter | - |
PUP72_RS08240 (PUP72_08240) | 1829454..1830683 | + | 1230 | WP_056847345.1 | Zn-dependent hydrolase | - |
PUP72_RS08245 (PUP72_08245) | 1830695..1831732 | + | 1038 | WP_046071436.1 | histone deacetylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1824527..1837804 | 13277 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11670.57 Da Isoelectric Point: 10.0575
>T272760 WP_046071432.1 NZ_CP118134:c1826921-1826607 [Pseudomonas synxantha]
MIFIETSVFTRRVKELIDEDAYMALQNVLVVNPSAGDVIEGTGGVRKIRVAAKGHGKRGGARVIYYHFVSASQIVLLMIY
PKNEQQDLTAVERKSLKAAIEHWR
MIFIETSVFTRRVKELIDEDAYMALQNVLVVNPSAGDVIEGTGGVRKIRVAAKGHGKRGGARVIYYHFVSASQIVLLMIY
PKNEQQDLTAVERKSLKAAIEHWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|